Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JMF5

Protein Details
Accession A0A2H3JMF5   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-84VPAVLKRNRRDDKEGKRWVRRKENAQFVGNHydrophilic
399-422SPSPSPAARRTRVRRVDPPRALVDHydrophilic
NLS Segment(s)
PositionSequence
61-76RNRRDDKEGKRWVRRK
Subcellular Location(s) nucl 13, cyto 12
Family & Domain DBs
Amino Acid Sequences MDATVTAVPAQPAAPAPAAPTDGPVPMSFPAILRTPGLSDRFAHLRPAVGDRVVVPAVLKRNRRDDKEGKRWVRRKENAQFVGNAHIVPPTKRDYAIPLPEKTPTFPAPLPPYIPRSVPIPPSAPPTHEPSSAAAGRFSLSLKGMRRTLRRAGPRTEALVRDVEGALLAWLADNVLLAPDDAAPLAFPGVPLGETGVVHEVQRAPLRLVWSVPDDAFARYVVHCCARFHGVVSFSKDDPPHRLTHLLRPNVTRPTRAPAARRAAPALDTPPATDLSEYHSSDATSDAYLSSDAASDVGSERDPDETFRLEAIAEASAPPSPALAPRAPQLLSDDEWSVVDADAESGDGSDIDADVARGMRGLTLRDANRGEGLGLGMAPRARRPVPDSVDYRAPRAASSPSPSPAARRTRVRRVDPPRALVDAGGERAQRSFYEYLYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.14
4 0.15
5 0.18
6 0.16
7 0.18
8 0.16
9 0.17
10 0.18
11 0.17
12 0.17
13 0.15
14 0.17
15 0.15
16 0.14
17 0.16
18 0.17
19 0.18
20 0.17
21 0.17
22 0.18
23 0.23
24 0.25
25 0.24
26 0.23
27 0.27
28 0.31
29 0.31
30 0.33
31 0.28
32 0.29
33 0.29
34 0.32
35 0.3
36 0.25
37 0.25
38 0.21
39 0.24
40 0.21
41 0.18
42 0.14
43 0.16
44 0.24
45 0.31
46 0.37
47 0.38
48 0.49
49 0.57
50 0.64
51 0.69
52 0.71
53 0.74
54 0.79
55 0.84
56 0.83
57 0.86
58 0.86
59 0.87
60 0.88
61 0.85
62 0.85
63 0.84
64 0.85
65 0.8
66 0.75
67 0.68
68 0.58
69 0.56
70 0.45
71 0.36
72 0.25
73 0.22
74 0.21
75 0.19
76 0.21
77 0.2
78 0.21
79 0.22
80 0.23
81 0.27
82 0.33
83 0.42
84 0.44
85 0.42
86 0.41
87 0.45
88 0.45
89 0.39
90 0.36
91 0.29
92 0.28
93 0.26
94 0.32
95 0.34
96 0.35
97 0.37
98 0.35
99 0.38
100 0.34
101 0.34
102 0.28
103 0.26
104 0.28
105 0.27
106 0.27
107 0.24
108 0.24
109 0.3
110 0.31
111 0.31
112 0.29
113 0.33
114 0.33
115 0.32
116 0.31
117 0.26
118 0.31
119 0.29
120 0.27
121 0.2
122 0.17
123 0.17
124 0.16
125 0.15
126 0.1
127 0.1
128 0.14
129 0.17
130 0.21
131 0.25
132 0.31
133 0.35
134 0.39
135 0.45
136 0.48
137 0.55
138 0.56
139 0.57
140 0.56
141 0.54
142 0.52
143 0.49
144 0.42
145 0.34
146 0.29
147 0.25
148 0.21
149 0.18
150 0.14
151 0.1
152 0.09
153 0.06
154 0.05
155 0.04
156 0.03
157 0.02
158 0.03
159 0.02
160 0.02
161 0.02
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.04
168 0.04
169 0.04
170 0.03
171 0.03
172 0.04
173 0.03
174 0.03
175 0.03
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.05
183 0.06
184 0.07
185 0.06
186 0.08
187 0.08
188 0.09
189 0.11
190 0.12
191 0.11
192 0.12
193 0.14
194 0.13
195 0.13
196 0.13
197 0.13
198 0.13
199 0.12
200 0.12
201 0.11
202 0.11
203 0.11
204 0.1
205 0.09
206 0.08
207 0.1
208 0.09
209 0.11
210 0.12
211 0.12
212 0.14
213 0.15
214 0.15
215 0.15
216 0.16
217 0.16
218 0.17
219 0.21
220 0.22
221 0.2
222 0.22
223 0.23
224 0.22
225 0.25
226 0.25
227 0.23
228 0.22
229 0.28
230 0.27
231 0.35
232 0.41
233 0.4
234 0.39
235 0.4
236 0.42
237 0.45
238 0.45
239 0.39
240 0.32
241 0.34
242 0.38
243 0.38
244 0.38
245 0.37
246 0.43
247 0.44
248 0.44
249 0.39
250 0.34
251 0.32
252 0.3
253 0.24
254 0.19
255 0.15
256 0.14
257 0.13
258 0.14
259 0.13
260 0.11
261 0.09
262 0.13
263 0.18
264 0.18
265 0.18
266 0.17
267 0.17
268 0.17
269 0.18
270 0.13
271 0.08
272 0.07
273 0.07
274 0.07
275 0.07
276 0.07
277 0.06
278 0.05
279 0.05
280 0.05
281 0.05
282 0.05
283 0.05
284 0.06
285 0.06
286 0.06
287 0.07
288 0.09
289 0.09
290 0.11
291 0.13
292 0.13
293 0.14
294 0.13
295 0.13
296 0.11
297 0.11
298 0.1
299 0.08
300 0.06
301 0.06
302 0.07
303 0.07
304 0.07
305 0.07
306 0.06
307 0.06
308 0.08
309 0.12
310 0.13
311 0.14
312 0.16
313 0.19
314 0.19
315 0.19
316 0.2
317 0.2
318 0.2
319 0.2
320 0.19
321 0.16
322 0.16
323 0.16
324 0.13
325 0.1
326 0.09
327 0.06
328 0.06
329 0.05
330 0.05
331 0.05
332 0.04
333 0.04
334 0.04
335 0.04
336 0.04
337 0.04
338 0.04
339 0.04
340 0.04
341 0.05
342 0.06
343 0.05
344 0.06
345 0.06
346 0.07
347 0.09
348 0.1
349 0.13
350 0.2
351 0.21
352 0.27
353 0.28
354 0.28
355 0.28
356 0.26
357 0.23
358 0.16
359 0.15
360 0.1
361 0.09
362 0.07
363 0.08
364 0.09
365 0.1
366 0.11
367 0.17
368 0.18
369 0.22
370 0.26
371 0.34
372 0.39
373 0.46
374 0.48
375 0.48
376 0.56
377 0.53
378 0.52
379 0.45
380 0.39
381 0.32
382 0.31
383 0.31
384 0.26
385 0.31
386 0.33
387 0.32
388 0.36
389 0.36
390 0.39
391 0.42
392 0.47
393 0.49
394 0.54
395 0.61
396 0.68
397 0.77
398 0.8
399 0.82
400 0.83
401 0.86
402 0.83
403 0.8
404 0.74
405 0.67
406 0.59
407 0.48
408 0.43
409 0.35
410 0.31
411 0.28
412 0.25
413 0.22
414 0.23
415 0.24
416 0.19
417 0.22
418 0.2