Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BT46

Protein Details
Accession G8BT46    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
162-189SLDKIFKSSKKVDSKKNKNKKKKNSKKKBasic
NLS Segment(s)
PositionSequence
169-189SSKKVDSKKNKNKKKKNSKKK
Subcellular Location(s) nucl 21, cyto_nucl 13.333, mito_nucl 12.999, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
KEGG tpf:TPHA_0D03840  -  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSTPTPVTGKLTSRVMNMKFMKFANNGEELTDPRGNASGALNNANANHKGRDSAITKKFNEASEWKLERMKINPESSDKSVNTTLTRKIIKIKKTPTVVSNVGVASLQRLRTPETNMLPVMRGRRVIGEPEVTLGKRKADEGNEEPSDSLQKEVDEDSYEPSLDKIFKSSKKVDSKKNKNKKKKNSKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.44
4 0.45
5 0.43
6 0.41
7 0.4
8 0.41
9 0.35
10 0.36
11 0.31
12 0.3
13 0.27
14 0.25
15 0.26
16 0.22
17 0.26
18 0.25
19 0.2
20 0.18
21 0.19
22 0.17
23 0.16
24 0.16
25 0.14
26 0.14
27 0.16
28 0.16
29 0.16
30 0.17
31 0.2
32 0.2
33 0.19
34 0.19
35 0.17
36 0.18
37 0.19
38 0.23
39 0.23
40 0.3
41 0.36
42 0.41
43 0.42
44 0.45
45 0.47
46 0.42
47 0.43
48 0.36
49 0.32
50 0.34
51 0.36
52 0.32
53 0.32
54 0.33
55 0.31
56 0.31
57 0.35
58 0.31
59 0.32
60 0.33
61 0.34
62 0.37
63 0.36
64 0.38
65 0.3
66 0.28
67 0.27
68 0.26
69 0.25
70 0.23
71 0.23
72 0.23
73 0.24
74 0.21
75 0.28
76 0.33
77 0.37
78 0.42
79 0.45
80 0.47
81 0.49
82 0.5
83 0.43
84 0.43
85 0.38
86 0.31
87 0.27
88 0.2
89 0.17
90 0.15
91 0.13
92 0.09
93 0.1
94 0.09
95 0.09
96 0.1
97 0.13
98 0.15
99 0.19
100 0.23
101 0.23
102 0.25
103 0.25
104 0.24
105 0.22
106 0.23
107 0.22
108 0.18
109 0.17
110 0.15
111 0.18
112 0.18
113 0.2
114 0.2
115 0.19
116 0.17
117 0.18
118 0.2
119 0.17
120 0.19
121 0.17
122 0.17
123 0.15
124 0.18
125 0.2
126 0.21
127 0.28
128 0.28
129 0.35
130 0.34
131 0.34
132 0.32
133 0.28
134 0.28
135 0.22
136 0.19
137 0.13
138 0.11
139 0.12
140 0.13
141 0.14
142 0.14
143 0.14
144 0.16
145 0.16
146 0.16
147 0.15
148 0.15
149 0.16
150 0.15
151 0.15
152 0.17
153 0.24
154 0.29
155 0.36
156 0.43
157 0.49
158 0.59
159 0.67
160 0.72
161 0.75
162 0.82
163 0.86
164 0.9
165 0.92
166 0.92
167 0.95
168 0.96
169 0.96