Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3JQA2

Protein Details
Accession A0A2H3JQA2    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
81-120PLDLRPKKTRAIRRRLTPHERSLKTLKQRKRDIHFPIRKYBasic
NLS Segment(s)
PositionSequence
75-118KKKKYLPLDLRPKKTRAIRRRLTPHERSLKTLKQRKRDIHFPIR
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLSKQLVELKEELLKLRVQKIAGGSAAKLTKINTVRKSIARVMTVMNQKARQNLREFYKKKKYLPLDLRPKKTRAIRRRLTPHERSLKTLKQRKRDIHFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.53
5 0.5
6 0.49
7 0.48
8 0.51
9 0.46
10 0.43
11 0.41
12 0.34
13 0.31
14 0.26
15 0.24
16 0.18
17 0.19
18 0.19
19 0.22
20 0.23
21 0.2
22 0.21
23 0.21
24 0.22
25 0.21
26 0.19
27 0.15
28 0.16
29 0.17
30 0.15
31 0.14
32 0.12
33 0.17
34 0.22
35 0.29
36 0.29
37 0.33
38 0.36
39 0.37
40 0.41
41 0.39
42 0.36
43 0.29
44 0.27
45 0.23
46 0.26
47 0.28
48 0.26
49 0.24
50 0.24
51 0.24
52 0.3
53 0.31
54 0.29
55 0.29
56 0.31
57 0.36
58 0.43
59 0.45
60 0.48
61 0.57
62 0.58
63 0.58
64 0.62
65 0.61
66 0.61
67 0.68
68 0.69
69 0.7
70 0.73
71 0.79
72 0.75
73 0.72
74 0.69
75 0.68
76 0.68
77 0.67
78 0.69
79 0.69
80 0.74
81 0.82
82 0.84
83 0.85
84 0.82
85 0.81
86 0.81
87 0.75
88 0.7
89 0.68
90 0.67
91 0.68
92 0.7
93 0.68
94 0.68
95 0.76
96 0.79
97 0.8
98 0.81
99 0.8
100 0.82
101 0.84
102 0.78
103 0.77
104 0.75