Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3K0C6

Protein Details
Accession A0A2H3K0C6    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
88-114VLSANPRAHPRRRRRRRLDARAARSLGHydrophilic
NLS Segment(s)
PositionSequence
93-108PRAHPRRRRRRRLDAR
Subcellular Location(s) mito 15, nucl 9, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MRLHPAQFSRRCAWPGRPRLPCPRAEHVHPRGATPPPLARARLERLPASGSLAENCLDACRPPTEPAKLRGARRAPCAPRIAGALADVLSANPRAHPRRRRRRRLDARAARSLGSTSEVRIDSVPPWALDERRTVPPKHVWPSSAHGCPQRVAPSPAPATPSDEGRLICHSRAAAVSAYVARSHAPARSGRKPVPARVYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.64
3 0.67
4 0.71
5 0.72
6 0.8
7 0.79
8 0.77
9 0.73
10 0.72
11 0.68
12 0.67
13 0.71
14 0.66
15 0.68
16 0.61
17 0.56
18 0.51
19 0.48
20 0.44
21 0.38
22 0.36
23 0.33
24 0.36
25 0.36
26 0.34
27 0.36
28 0.38
29 0.39
30 0.39
31 0.34
32 0.32
33 0.33
34 0.3
35 0.28
36 0.23
37 0.19
38 0.16
39 0.16
40 0.14
41 0.12
42 0.12
43 0.09
44 0.08
45 0.08
46 0.09
47 0.1
48 0.12
49 0.15
50 0.2
51 0.26
52 0.3
53 0.34
54 0.42
55 0.45
56 0.46
57 0.51
58 0.53
59 0.49
60 0.52
61 0.56
62 0.5
63 0.49
64 0.5
65 0.42
66 0.36
67 0.34
68 0.28
69 0.19
70 0.16
71 0.11
72 0.08
73 0.08
74 0.07
75 0.05
76 0.05
77 0.06
78 0.06
79 0.07
80 0.12
81 0.18
82 0.26
83 0.36
84 0.47
85 0.57
86 0.68
87 0.78
88 0.82
89 0.88
90 0.91
91 0.92
92 0.93
93 0.91
94 0.87
95 0.82
96 0.73
97 0.62
98 0.51
99 0.4
100 0.29
101 0.22
102 0.16
103 0.1
104 0.12
105 0.12
106 0.12
107 0.12
108 0.13
109 0.1
110 0.13
111 0.13
112 0.1
113 0.12
114 0.13
115 0.14
116 0.15
117 0.18
118 0.2
119 0.27
120 0.31
121 0.29
122 0.33
123 0.4
124 0.46
125 0.48
126 0.46
127 0.4
128 0.39
129 0.45
130 0.47
131 0.42
132 0.38
133 0.37
134 0.37
135 0.35
136 0.35
137 0.34
138 0.32
139 0.34
140 0.32
141 0.34
142 0.35
143 0.36
144 0.35
145 0.31
146 0.32
147 0.28
148 0.28
149 0.23
150 0.24
151 0.23
152 0.22
153 0.27
154 0.24
155 0.23
156 0.23
157 0.21
158 0.19
159 0.2
160 0.2
161 0.14
162 0.12
163 0.14
164 0.13
165 0.14
166 0.13
167 0.13
168 0.11
169 0.13
170 0.14
171 0.15
172 0.17
173 0.24
174 0.32
175 0.4
176 0.47
177 0.5
178 0.58
179 0.62
180 0.67