Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3JMN5

Protein Details
Accession A0A2H3JMN5    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-31SSSPYGRTHVWKHRQKKMPKPFVPQFPQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, mito_nucl 11, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences RGVSSSPYGRTHVWKHRQKKMPKPFVPQFPQRVIRADGSTFTHYTTSPRSSVRLTRDTTNNPVWNAAKWMAENEEEDVITGRLGRFNRRFDGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.67
3 0.74
4 0.81
5 0.84
6 0.86
7 0.87
8 0.88
9 0.85
10 0.85
11 0.83
12 0.83
13 0.8
14 0.77
15 0.71
16 0.67
17 0.65
18 0.57
19 0.52
20 0.45
21 0.4
22 0.34
23 0.29
24 0.24
25 0.22
26 0.23
27 0.19
28 0.17
29 0.16
30 0.14
31 0.15
32 0.17
33 0.16
34 0.15
35 0.16
36 0.17
37 0.19
38 0.24
39 0.28
40 0.3
41 0.3
42 0.33
43 0.38
44 0.4
45 0.43
46 0.44
47 0.41
48 0.36
49 0.37
50 0.34
51 0.29
52 0.29
53 0.25
54 0.2
55 0.17
56 0.18
57 0.17
58 0.17
59 0.17
60 0.15
61 0.15
62 0.13
63 0.13
64 0.13
65 0.11
66 0.1
67 0.1
68 0.09
69 0.13
70 0.15
71 0.25
72 0.3
73 0.36