Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JZV0

Protein Details
Accession A0A2H3JZV0    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
11-38RAPSLQSTVQRRRRPPHQPRPWIGRPPAHydrophilic
201-238AAHQVERQRRLPKQPRHPFRRPRPHAHKAGRAVRQSRKBasic
NLS Segment(s)
PositionSequence
22-26RRRPP
102-130YRQRRLWGKTQPKGPPTRTVKTRKAPHGP
205-239VERQRRLPKQPRHPFRRPRPHAHKAGRAVRQSRKV
Subcellular Location(s) mito 21, cyto 5
Family & Domain DBs
Amino Acid Sequences MQAWGVPAPPRAPSLQSTVQRRRRPPHQPRPWIGRPPAAPCPARLPVREDQRVGDRLCARARRLGNGASTWVASGTGPTVRLGQDAQADRQRSAGQPLHKPYRQRRLWGKTQPKGPPTRTVKTRKAPHGPKDTRVQTRTPPDPSGSDKTTPVNGRAPAEGHTARATARVEQTQPQATATSPLSVKTAPKVGKGAQSPRQPAAHQVERQRRLPKQPRHPFRRPRPHAHKAGRAVRQSRKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.41
4 0.5
5 0.58
6 0.65
7 0.71
8 0.77
9 0.78
10 0.8
11 0.84
12 0.85
13 0.86
14 0.87
15 0.89
16 0.88
17 0.89
18 0.88
19 0.86
20 0.79
21 0.75
22 0.67
23 0.63
24 0.63
25 0.6
26 0.52
27 0.45
28 0.47
29 0.47
30 0.47
31 0.42
32 0.4
33 0.41
34 0.5
35 0.53
36 0.47
37 0.43
38 0.46
39 0.49
40 0.44
41 0.43
42 0.36
43 0.36
44 0.41
45 0.42
46 0.37
47 0.39
48 0.4
49 0.38
50 0.39
51 0.37
52 0.33
53 0.29
54 0.29
55 0.22
56 0.21
57 0.16
58 0.13
59 0.1
60 0.08
61 0.07
62 0.06
63 0.07
64 0.07
65 0.08
66 0.09
67 0.09
68 0.1
69 0.1
70 0.1
71 0.15
72 0.16
73 0.19
74 0.23
75 0.24
76 0.23
77 0.24
78 0.24
79 0.19
80 0.24
81 0.24
82 0.25
83 0.3
84 0.36
85 0.43
86 0.44
87 0.51
88 0.53
89 0.59
90 0.57
91 0.59
92 0.62
93 0.61
94 0.68
95 0.71
96 0.73
97 0.67
98 0.72
99 0.7
100 0.66
101 0.66
102 0.58
103 0.58
104 0.55
105 0.55
106 0.56
107 0.59
108 0.61
109 0.63
110 0.68
111 0.66
112 0.7
113 0.71
114 0.71
115 0.74
116 0.69
117 0.64
118 0.65
119 0.64
120 0.61
121 0.56
122 0.5
123 0.45
124 0.49
125 0.51
126 0.46
127 0.41
128 0.35
129 0.36
130 0.39
131 0.38
132 0.34
133 0.3
134 0.28
135 0.28
136 0.31
137 0.3
138 0.27
139 0.26
140 0.25
141 0.25
142 0.25
143 0.24
144 0.2
145 0.25
146 0.22
147 0.19
148 0.18
149 0.17
150 0.16
151 0.18
152 0.17
153 0.14
154 0.17
155 0.19
156 0.2
157 0.23
158 0.28
159 0.28
160 0.27
161 0.25
162 0.23
163 0.2
164 0.22
165 0.19
166 0.18
167 0.14
168 0.14
169 0.15
170 0.16
171 0.17
172 0.16
173 0.23
174 0.22
175 0.24
176 0.27
177 0.28
178 0.34
179 0.39
180 0.44
181 0.45
182 0.51
183 0.53
184 0.54
185 0.54
186 0.48
187 0.49
188 0.5
189 0.5
190 0.48
191 0.54
192 0.6
193 0.62
194 0.69
195 0.7
196 0.67
197 0.7
198 0.75
199 0.76
200 0.77
201 0.82
202 0.86
203 0.87
204 0.92
205 0.92
206 0.92
207 0.93
208 0.91
209 0.91
210 0.9
211 0.91
212 0.91
213 0.89
214 0.87
215 0.86
216 0.86
217 0.83
218 0.82
219 0.8