Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JT80

Protein Details
Accession A0A2H3JT80   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
29-54HRSTARARRCSRARRRRPSSARTSRHBasic
NLS Segment(s)
PositionSequence
30-50RSTARARRCSRARRRRPSSAR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
Amino Acid Sequences MSIHGEVHSIHGWHSLQREHGDGFRRSTHRSTARARRCSRARRRRPSSARTSRHTPRCPCSLHELTKPCRRCAVAVVARTFDPGRWARCAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.22
4 0.24
5 0.26
6 0.23
7 0.27
8 0.31
9 0.3
10 0.31
11 0.34
12 0.35
13 0.37
14 0.38
15 0.42
16 0.42
17 0.46
18 0.51
19 0.55
20 0.62
21 0.67
22 0.68
23 0.68
24 0.71
25 0.76
26 0.78
27 0.79
28 0.8
29 0.81
30 0.86
31 0.87
32 0.87
33 0.84
34 0.84
35 0.83
36 0.78
37 0.73
38 0.73
39 0.71
40 0.72
41 0.72
42 0.67
43 0.61
44 0.62
45 0.58
46 0.53
47 0.54
48 0.51
49 0.48
50 0.5
51 0.52
52 0.53
53 0.6
54 0.61
55 0.54
56 0.52
57 0.48
58 0.42
59 0.4
60 0.43
61 0.41
62 0.44
63 0.44
64 0.41
65 0.39
66 0.4
67 0.36
68 0.26
69 0.26
70 0.26
71 0.27