Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AJJ3

Protein Details
Accession G3AJJ3   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
148-173IYKNRLMLTQKKKYQKERYEKMHSEGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
KEGG spaa:SPAPADRAFT_70142  -  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MNKAPPFPNKYNIRLVAANDSKSCTICYKPSTTVLVSDNQADFFYTCPQHLLDEHFATPIQPQSYLDLVKQKEELEAKKTQLEKDIELEKPYLWNKVSEYWQKSDNKKEKSKFEKLNDELKQVIEQLSDKQKEVSEFKFKVYKLNLDIYKNRLMLTQKKKYQKERYEKMHSEGFFPSAPKNDIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.5
4 0.47
5 0.44
6 0.37
7 0.37
8 0.33
9 0.31
10 0.31
11 0.24
12 0.23
13 0.26
14 0.3
15 0.31
16 0.33
17 0.36
18 0.38
19 0.35
20 0.35
21 0.31
22 0.3
23 0.26
24 0.26
25 0.22
26 0.19
27 0.18
28 0.15
29 0.14
30 0.11
31 0.15
32 0.13
33 0.13
34 0.14
35 0.14
36 0.15
37 0.16
38 0.2
39 0.19
40 0.21
41 0.21
42 0.2
43 0.19
44 0.18
45 0.18
46 0.16
47 0.12
48 0.11
49 0.11
50 0.13
51 0.15
52 0.16
53 0.16
54 0.19
55 0.19
56 0.2
57 0.2
58 0.18
59 0.19
60 0.23
61 0.23
62 0.21
63 0.24
64 0.24
65 0.28
66 0.29
67 0.27
68 0.29
69 0.29
70 0.25
71 0.25
72 0.28
73 0.24
74 0.23
75 0.23
76 0.16
77 0.18
78 0.18
79 0.17
80 0.14
81 0.14
82 0.14
83 0.17
84 0.23
85 0.26
86 0.29
87 0.28
88 0.34
89 0.39
90 0.42
91 0.49
92 0.52
93 0.53
94 0.58
95 0.62
96 0.66
97 0.69
98 0.74
99 0.72
100 0.7
101 0.72
102 0.67
103 0.71
104 0.63
105 0.57
106 0.49
107 0.41
108 0.35
109 0.25
110 0.22
111 0.13
112 0.12
113 0.14
114 0.22
115 0.23
116 0.22
117 0.23
118 0.24
119 0.27
120 0.31
121 0.31
122 0.32
123 0.32
124 0.35
125 0.39
126 0.38
127 0.41
128 0.4
129 0.41
130 0.35
131 0.43
132 0.44
133 0.44
134 0.48
135 0.45
136 0.48
137 0.43
138 0.4
139 0.35
140 0.37
141 0.41
142 0.47
143 0.52
144 0.55
145 0.64
146 0.73
147 0.79
148 0.84
149 0.85
150 0.86
151 0.86
152 0.87
153 0.88
154 0.84
155 0.78
156 0.74
157 0.64
158 0.56
159 0.48
160 0.42
161 0.33
162 0.3
163 0.29
164 0.27