Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JTH0

Protein Details
Accession A0A2H3JTH0   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
195-220NEKQKEQREKASSKKKPKAAAKPILGHydrophilic
NLS Segment(s)
PositionSequence
54-63APPKKKGTLK
199-217KEQREKASSKKKPKAAAKP
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR023194  eIF3-like_dom_sf  
IPR013906  eIF3j  
Gene Ontology GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF08597  eIF3_subunit  
Amino Acid Sequences EASEDESPAAPSAPAVKKPVKSKWEGEDEEDDAPSDWEASSDEEKPKAASAPVAPPKKKGTLKAKLAEIEAEKAARAAAGDDDYDEDAVLDPREKARLDRERELNADLSNAADLLGAAALGGTSSSELDYLISAQPRTKEDFIKFSDKVIEYIIKRHQNKPLYATFLEHHVRELAMPLRDVEVRKTASVLTTLANEKQKEQREKASSKKKPKAAAKPILGSAKVSNKVDTSVYDEALDDLDSNPDDFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.36
4 0.41
5 0.5
6 0.58
7 0.57
8 0.59
9 0.61
10 0.63
11 0.66
12 0.63
13 0.6
14 0.55
15 0.5
16 0.45
17 0.39
18 0.31
19 0.22
20 0.2
21 0.15
22 0.11
23 0.08
24 0.07
25 0.08
26 0.11
27 0.13
28 0.17
29 0.2
30 0.21
31 0.21
32 0.22
33 0.22
34 0.2
35 0.18
36 0.17
37 0.17
38 0.25
39 0.33
40 0.41
41 0.41
42 0.44
43 0.47
44 0.53
45 0.54
46 0.54
47 0.56
48 0.57
49 0.65
50 0.66
51 0.66
52 0.59
53 0.55
54 0.49
55 0.4
56 0.32
57 0.25
58 0.19
59 0.15
60 0.13
61 0.12
62 0.09
63 0.07
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.08
70 0.08
71 0.08
72 0.07
73 0.06
74 0.06
75 0.06
76 0.07
77 0.06
78 0.07
79 0.07
80 0.1
81 0.1
82 0.12
83 0.2
84 0.29
85 0.34
86 0.4
87 0.44
88 0.44
89 0.45
90 0.45
91 0.37
92 0.29
93 0.23
94 0.16
95 0.12
96 0.09
97 0.07
98 0.05
99 0.04
100 0.03
101 0.03
102 0.03
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.03
114 0.03
115 0.03
116 0.03
117 0.05
118 0.06
119 0.07
120 0.07
121 0.09
122 0.1
123 0.12
124 0.17
125 0.18
126 0.21
127 0.22
128 0.27
129 0.3
130 0.35
131 0.33
132 0.29
133 0.32
134 0.28
135 0.27
136 0.23
137 0.24
138 0.18
139 0.23
140 0.29
141 0.33
142 0.36
143 0.4
144 0.46
145 0.47
146 0.49
147 0.49
148 0.46
149 0.43
150 0.4
151 0.38
152 0.31
153 0.31
154 0.31
155 0.25
156 0.22
157 0.17
158 0.17
159 0.14
160 0.17
161 0.15
162 0.14
163 0.14
164 0.13
165 0.15
166 0.17
167 0.18
168 0.18
169 0.19
170 0.2
171 0.2
172 0.2
173 0.18
174 0.17
175 0.17
176 0.16
177 0.11
178 0.13
179 0.15
180 0.19
181 0.24
182 0.24
183 0.26
184 0.33
185 0.42
186 0.47
187 0.5
188 0.54
189 0.58
190 0.64
191 0.71
192 0.74
193 0.75
194 0.78
195 0.82
196 0.8
197 0.8
198 0.84
199 0.84
200 0.84
201 0.83
202 0.79
203 0.74
204 0.73
205 0.68
206 0.58
207 0.5
208 0.44
209 0.42
210 0.42
211 0.39
212 0.35
213 0.31
214 0.33
215 0.32
216 0.28
217 0.27
218 0.24
219 0.23
220 0.21
221 0.21
222 0.19
223 0.18
224 0.17
225 0.11
226 0.09
227 0.11
228 0.11