Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BP92

Protein Details
Accession G8BP92    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
376-396ITPSRKAKTLETNKRKHHINNHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5cyto_nucl 12.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000898  Indolamine_dOase  
IPR037217  Trp/Indoleamine_2_3_dOase-like  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0020037  F:heme binding  
GO:0046872  F:metal ion binding  
GO:0019441  P:tryptophan catabolic process to kynurenine  
KEGG tpf:TPHA_0B01500  -  
Pfam View protein in Pfam  
PF01231  IDO  
PROSITE View protein in PROSITE  
PS00876  IDO_1  
Amino Acid Sequences MTGILNYIRGVRNDDITLEKYAISAKYGFLSTKQPVQFINIEYYKPWEDIIENLPDLLKEGNLREEIDTNLPILEVSDELLNNVFYLRRAYSILTFLTNAYVWGNKFNGETPIEILSDNIAKPLLKIANILGLPPLSTYAGLILWNFKTVSANNLCCETDPIQIEILNTFTDLDDERWFYIISVFYEKIGGSVLECGVEILNAIKNEDIRLLKSRLNLISSYTYILGDLFTRMNEHTNPDIFYNVLRPFLTGWENSKDLGLPNGVKYGRHGKYKKFAGGSNAQSSLIQFIDILLNVEHKNEEGVANGLSYILEMRKYMPYLHRKFLEHFSAACKLKEFVLKHADDHPDLVKDYDDCLDNLKMFRDKHVKLVTTYIITPSRKAKTLETNKRKHHINNGLAIKGTGSTSFVLFLKQCRTDTVDAGINFKKGKRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.29
4 0.3
5 0.25
6 0.22
7 0.19
8 0.22
9 0.2
10 0.18
11 0.16
12 0.15
13 0.17
14 0.18
15 0.19
16 0.18
17 0.24
18 0.25
19 0.32
20 0.33
21 0.33
22 0.32
23 0.36
24 0.37
25 0.33
26 0.38
27 0.32
28 0.31
29 0.3
30 0.34
31 0.31
32 0.28
33 0.26
34 0.19
35 0.17
36 0.2
37 0.23
38 0.22
39 0.2
40 0.2
41 0.2
42 0.18
43 0.18
44 0.15
45 0.12
46 0.1
47 0.12
48 0.16
49 0.17
50 0.19
51 0.19
52 0.2
53 0.22
54 0.22
55 0.21
56 0.17
57 0.15
58 0.14
59 0.12
60 0.11
61 0.09
62 0.06
63 0.06
64 0.08
65 0.07
66 0.08
67 0.09
68 0.08
69 0.08
70 0.08
71 0.08
72 0.07
73 0.1
74 0.11
75 0.12
76 0.13
77 0.15
78 0.16
79 0.18
80 0.19
81 0.17
82 0.17
83 0.15
84 0.16
85 0.14
86 0.12
87 0.11
88 0.12
89 0.11
90 0.14
91 0.14
92 0.14
93 0.15
94 0.16
95 0.19
96 0.17
97 0.18
98 0.16
99 0.17
100 0.17
101 0.16
102 0.14
103 0.12
104 0.13
105 0.12
106 0.1
107 0.1
108 0.09
109 0.09
110 0.14
111 0.14
112 0.12
113 0.13
114 0.13
115 0.18
116 0.18
117 0.18
118 0.13
119 0.12
120 0.11
121 0.1
122 0.11
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.07
129 0.07
130 0.09
131 0.08
132 0.1
133 0.1
134 0.09
135 0.11
136 0.11
137 0.17
138 0.2
139 0.22
140 0.21
141 0.23
142 0.23
143 0.21
144 0.25
145 0.2
146 0.19
147 0.18
148 0.18
149 0.17
150 0.17
151 0.17
152 0.14
153 0.13
154 0.08
155 0.07
156 0.07
157 0.06
158 0.06
159 0.07
160 0.08
161 0.09
162 0.1
163 0.1
164 0.1
165 0.1
166 0.1
167 0.11
168 0.1
169 0.1
170 0.12
171 0.12
172 0.12
173 0.13
174 0.12
175 0.11
176 0.1
177 0.08
178 0.05
179 0.06
180 0.06
181 0.05
182 0.05
183 0.05
184 0.04
185 0.04
186 0.04
187 0.04
188 0.06
189 0.06
190 0.06
191 0.07
192 0.07
193 0.07
194 0.11
195 0.1
196 0.1
197 0.14
198 0.17
199 0.18
200 0.2
201 0.23
202 0.21
203 0.22
204 0.2
205 0.18
206 0.18
207 0.16
208 0.16
209 0.13
210 0.11
211 0.1
212 0.1
213 0.08
214 0.06
215 0.06
216 0.06
217 0.05
218 0.07
219 0.07
220 0.09
221 0.1
222 0.12
223 0.14
224 0.15
225 0.15
226 0.15
227 0.15
228 0.13
229 0.12
230 0.14
231 0.12
232 0.13
233 0.12
234 0.12
235 0.12
236 0.14
237 0.16
238 0.12
239 0.15
240 0.16
241 0.17
242 0.17
243 0.17
244 0.15
245 0.13
246 0.13
247 0.12
248 0.1
249 0.1
250 0.15
251 0.15
252 0.14
253 0.17
254 0.25
255 0.27
256 0.36
257 0.39
258 0.4
259 0.49
260 0.54
261 0.57
262 0.5
263 0.47
264 0.44
265 0.48
266 0.47
267 0.41
268 0.37
269 0.32
270 0.29
271 0.27
272 0.23
273 0.15
274 0.11
275 0.07
276 0.06
277 0.07
278 0.07
279 0.08
280 0.06
281 0.09
282 0.09
283 0.1
284 0.09
285 0.08
286 0.09
287 0.09
288 0.09
289 0.07
290 0.08
291 0.07
292 0.07
293 0.07
294 0.07
295 0.06
296 0.06
297 0.06
298 0.06
299 0.06
300 0.06
301 0.09
302 0.11
303 0.12
304 0.16
305 0.24
306 0.34
307 0.39
308 0.45
309 0.47
310 0.48
311 0.5
312 0.53
313 0.5
314 0.42
315 0.37
316 0.35
317 0.39
318 0.38
319 0.35
320 0.3
321 0.24
322 0.26
323 0.32
324 0.29
325 0.28
326 0.34
327 0.35
328 0.35
329 0.41
330 0.42
331 0.36
332 0.36
333 0.32
334 0.25
335 0.25
336 0.24
337 0.19
338 0.15
339 0.16
340 0.16
341 0.15
342 0.13
343 0.16
344 0.17
345 0.18
346 0.19
347 0.21
348 0.25
349 0.24
350 0.32
351 0.38
352 0.37
353 0.45
354 0.51
355 0.49
356 0.45
357 0.5
358 0.44
359 0.38
360 0.37
361 0.33
362 0.33
363 0.31
364 0.33
365 0.36
366 0.37
367 0.39
368 0.41
369 0.43
370 0.47
371 0.57
372 0.65
373 0.68
374 0.74
375 0.77
376 0.82
377 0.83
378 0.78
379 0.77
380 0.76
381 0.73
382 0.72
383 0.69
384 0.64
385 0.57
386 0.5
387 0.4
388 0.3
389 0.24
390 0.15
391 0.11
392 0.11
393 0.11
394 0.13
395 0.13
396 0.15
397 0.16
398 0.2
399 0.26
400 0.3
401 0.3
402 0.32
403 0.38
404 0.37
405 0.38
406 0.38
407 0.38
408 0.34
409 0.39
410 0.38
411 0.35
412 0.35
413 0.35