Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3JIA1

Protein Details
Accession A0A2H3JIA1    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-30EHVVVHKKKSRDNKAYKQKQKQAMNVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.333, nucl 10, mito_nucl 9.999, mito 8.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MAYKEHVVVHKKKSRDNKAYKQKQKQAMNVNAGTEELGANYVSALLAWIWFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.73
3 0.76
4 0.77
5 0.82
6 0.89
7 0.91
8 0.9
9 0.88
10 0.86
11 0.82
12 0.79
13 0.77
14 0.72
15 0.67
16 0.58
17 0.5
18 0.41
19 0.34
20 0.27
21 0.18
22 0.11
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04