Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JJZ3

Protein Details
Accession A0A2H3JJZ3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-62SCCTLHCRPCHRRHHDPPAPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 4, plas 4
Family & Domain DBs
Amino Acid Sequences MDAPCPLTRTSSTTRVVPSGPVNPIVLLVTAPMFASTLAPPISCCTLHCRPCHRRHHDPPAPAVCASSRCMPPPLCVCMSRCCSWINAAFASANQPWTSRCIFGTVRCATCTGHSILAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.36
4 0.33
5 0.31
6 0.29
7 0.28
8 0.26
9 0.24
10 0.22
11 0.21
12 0.18
13 0.14
14 0.09
15 0.08
16 0.06
17 0.06
18 0.06
19 0.05
20 0.05
21 0.05
22 0.06
23 0.06
24 0.08
25 0.08
26 0.08
27 0.08
28 0.1
29 0.12
30 0.11
31 0.11
32 0.17
33 0.24
34 0.3
35 0.35
36 0.43
37 0.5
38 0.6
39 0.7
40 0.7
41 0.73
42 0.76
43 0.83
44 0.79
45 0.72
46 0.69
47 0.62
48 0.55
49 0.44
50 0.36
51 0.26
52 0.21
53 0.21
54 0.18
55 0.16
56 0.16
57 0.2
58 0.2
59 0.23
60 0.24
61 0.26
62 0.24
63 0.25
64 0.26
65 0.29
66 0.33
67 0.31
68 0.29
69 0.26
70 0.24
71 0.26
72 0.28
73 0.25
74 0.2
75 0.2
76 0.19
77 0.18
78 0.21
79 0.18
80 0.16
81 0.13
82 0.14
83 0.14
84 0.18
85 0.2
86 0.17
87 0.16
88 0.2
89 0.22
90 0.25
91 0.33
92 0.35
93 0.35
94 0.34
95 0.35
96 0.31
97 0.31
98 0.31
99 0.25