Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3J736

Protein Details
Accession A0A2H3J736    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
40-64VTRGAGFRKEKNKKKRGSYRGGEITBasic
NLS Segment(s)
PositionSequence
46-56FRKEKNKKKRG
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences QRVKPETVSFLDERLKDNRFESRVTRPNDYGEQAARDLIVTRGAGFRKEKNKKKRGSYRGGEITLESHSIKFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.28
4 0.3
5 0.34
6 0.3
7 0.32
8 0.33
9 0.38
10 0.44
11 0.46
12 0.48
13 0.42
14 0.43
15 0.43
16 0.4
17 0.32
18 0.26
19 0.23
20 0.19
21 0.17
22 0.13
23 0.1
24 0.09
25 0.07
26 0.07
27 0.06
28 0.06
29 0.09
30 0.1
31 0.13
32 0.15
33 0.22
34 0.31
35 0.42
36 0.51
37 0.59
38 0.68
39 0.74
40 0.82
41 0.87
42 0.86
43 0.86
44 0.82
45 0.81
46 0.79
47 0.73
48 0.63
49 0.52
50 0.44
51 0.35
52 0.31
53 0.23
54 0.15