Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3IV57

Protein Details
Accession A0A2H3IV57    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
58-77SSQHSASRPAKRRHEPDDDSHydrophilic
87-111MESNSPPPERPKRSAPKRARTTPALHydrophilic
NLS Segment(s)
PositionSequence
96-106RPKRSAPKRAR
Subcellular Location(s) nucl 18, mito 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013868  Cut8/Sts1_fam  
IPR038422  Cut8/Sts1_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0071630  P:nuclear protein quality control by the ubiquitin-proteasome system  
GO:0031144  P:proteasome localization  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF08559  Cut8  
Amino Acid Sequences MANVVTHPQLQVDFHRGPLHHSPSPLGFGFGLSNTPVMGGWSATPSHALQPSWPAATSSQHSASRPAKRRHEPDDDSDLRGTRDESMESNSPPPERPKRSAPKRARTTPALVVTGKEEKNSKENKPPPASDENDVDVGVLLASLPPQSLLPLLTSLLAAQPSLKSTVLSLIPRPTLDTAMQALAVSANKLRDAYPYSTSPFSQPGPSYSPGFGMGSFASNRAGSPSPAGFGFGRPSAVSAFSSTPSQPPNNGMRDEYIINRMRPHITEFVSACLSYLPYFSYAAPPSSSPSQKLHTQSHAAALQLQHKDRSHPTETYLFLSALTTHVLNQPPLAQASLAPLLLPRLTDEWRAWIDRVDQLVNREGGMFGSETVRSWERGLDELAQAKGNGFEVFRQLRDMWVSKVGWLLGRQAMEEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.31
4 0.36
5 0.43
6 0.46
7 0.42
8 0.42
9 0.43
10 0.4
11 0.44
12 0.38
13 0.31
14 0.23
15 0.2
16 0.2
17 0.17
18 0.16
19 0.12
20 0.12
21 0.1
22 0.1
23 0.09
24 0.09
25 0.09
26 0.08
27 0.08
28 0.1
29 0.1
30 0.1
31 0.13
32 0.13
33 0.18
34 0.2
35 0.2
36 0.19
37 0.25
38 0.28
39 0.27
40 0.26
41 0.23
42 0.21
43 0.25
44 0.27
45 0.26
46 0.28
47 0.3
48 0.31
49 0.37
50 0.44
51 0.5
52 0.57
53 0.61
54 0.65
55 0.72
56 0.79
57 0.79
58 0.81
59 0.76
60 0.73
61 0.74
62 0.66
63 0.6
64 0.54
65 0.47
66 0.38
67 0.33
68 0.27
69 0.2
70 0.18
71 0.17
72 0.16
73 0.2
74 0.22
75 0.23
76 0.26
77 0.26
78 0.26
79 0.28
80 0.35
81 0.4
82 0.44
83 0.48
84 0.55
85 0.64
86 0.72
87 0.8
88 0.82
89 0.82
90 0.85
91 0.88
92 0.84
93 0.78
94 0.73
95 0.69
96 0.62
97 0.55
98 0.46
99 0.38
100 0.35
101 0.37
102 0.32
103 0.27
104 0.25
105 0.24
106 0.32
107 0.38
108 0.39
109 0.43
110 0.49
111 0.57
112 0.6
113 0.59
114 0.57
115 0.58
116 0.56
117 0.49
118 0.45
119 0.37
120 0.32
121 0.3
122 0.23
123 0.16
124 0.12
125 0.09
126 0.05
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.04
133 0.04
134 0.04
135 0.05
136 0.05
137 0.06
138 0.06
139 0.07
140 0.06
141 0.06
142 0.06
143 0.07
144 0.06
145 0.06
146 0.06
147 0.06
148 0.07
149 0.09
150 0.09
151 0.08
152 0.08
153 0.11
154 0.13
155 0.14
156 0.15
157 0.16
158 0.17
159 0.17
160 0.18
161 0.16
162 0.15
163 0.14
164 0.13
165 0.12
166 0.11
167 0.11
168 0.09
169 0.08
170 0.07
171 0.07
172 0.06
173 0.06
174 0.06
175 0.07
176 0.07
177 0.08
178 0.09
179 0.13
180 0.16
181 0.17
182 0.19
183 0.21
184 0.21
185 0.22
186 0.21
187 0.19
188 0.17
189 0.17
190 0.15
191 0.16
192 0.19
193 0.2
194 0.2
195 0.18
196 0.18
197 0.16
198 0.16
199 0.13
200 0.1
201 0.08
202 0.08
203 0.08
204 0.08
205 0.08
206 0.08
207 0.08
208 0.09
209 0.1
210 0.09
211 0.11
212 0.1
213 0.1
214 0.1
215 0.12
216 0.1
217 0.1
218 0.11
219 0.1
220 0.1
221 0.09
222 0.1
223 0.09
224 0.1
225 0.09
226 0.09
227 0.1
228 0.1
229 0.12
230 0.12
231 0.14
232 0.16
233 0.17
234 0.16
235 0.2
236 0.25
237 0.27
238 0.27
239 0.26
240 0.24
241 0.25
242 0.26
243 0.22
244 0.24
245 0.24
246 0.23
247 0.24
248 0.25
249 0.24
250 0.24
251 0.27
252 0.24
253 0.22
254 0.25
255 0.24
256 0.24
257 0.24
258 0.22
259 0.18
260 0.14
261 0.12
262 0.09
263 0.09
264 0.07
265 0.07
266 0.09
267 0.09
268 0.13
269 0.14
270 0.15
271 0.15
272 0.15
273 0.18
274 0.23
275 0.24
276 0.23
277 0.25
278 0.28
279 0.33
280 0.38
281 0.39
282 0.38
283 0.4
284 0.38
285 0.39
286 0.37
287 0.31
288 0.27
289 0.25
290 0.27
291 0.27
292 0.28
293 0.29
294 0.28
295 0.33
296 0.35
297 0.4
298 0.38
299 0.35
300 0.37
301 0.37
302 0.38
303 0.37
304 0.33
305 0.26
306 0.21
307 0.2
308 0.17
309 0.12
310 0.12
311 0.09
312 0.09
313 0.13
314 0.15
315 0.15
316 0.15
317 0.17
318 0.17
319 0.18
320 0.17
321 0.12
322 0.1
323 0.14
324 0.15
325 0.12
326 0.11
327 0.1
328 0.11
329 0.12
330 0.11
331 0.1
332 0.11
333 0.14
334 0.18
335 0.18
336 0.22
337 0.25
338 0.27
339 0.26
340 0.26
341 0.27
342 0.27
343 0.3
344 0.28
345 0.27
346 0.28
347 0.32
348 0.3
349 0.27
350 0.23
351 0.2
352 0.16
353 0.16
354 0.13
355 0.09
356 0.1
357 0.1
358 0.1
359 0.15
360 0.17
361 0.17
362 0.17
363 0.19
364 0.19
365 0.21
366 0.23
367 0.21
368 0.23
369 0.26
370 0.26
371 0.25
372 0.23
373 0.21
374 0.2
375 0.18
376 0.16
377 0.13
378 0.13
379 0.2
380 0.23
381 0.23
382 0.26
383 0.25
384 0.27
385 0.33
386 0.34
387 0.29
388 0.33
389 0.32
390 0.29
391 0.31
392 0.29
393 0.26
394 0.25
395 0.26
396 0.24
397 0.24