Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3JT00

Protein Details
Accession A0A2H3JT00    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
85-110PSASRAVSTKRRKRNWSELLPPRERHHydrophilic
NLS Segment(s)
PositionSequence
94-98KRRKR
Subcellular Location(s) nucl 12, cyto 8, mito_nucl 8
Family & Domain DBs
Amino Acid Sequences MLGVFNEDLAMDSWPENDKAIPIIPLTTLASRRASVWASGRPGLGKIPELPTHDGAYDGTNKGPDVPRLRSPAPIAGPSSTAAGPSASRAVSTKRRKRNWSELLPPRERHEHMAKWARQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.12
5 0.12
6 0.13
7 0.13
8 0.13
9 0.11
10 0.11
11 0.1
12 0.12
13 0.13
14 0.14
15 0.14
16 0.16
17 0.18
18 0.17
19 0.18
20 0.19
21 0.18
22 0.18
23 0.21
24 0.22
25 0.23
26 0.24
27 0.24
28 0.21
29 0.21
30 0.19
31 0.17
32 0.14
33 0.12
34 0.15
35 0.17
36 0.2
37 0.22
38 0.22
39 0.22
40 0.2
41 0.19
42 0.16
43 0.14
44 0.13
45 0.11
46 0.09
47 0.09
48 0.09
49 0.11
50 0.11
51 0.15
52 0.18
53 0.21
54 0.25
55 0.3
56 0.31
57 0.32
58 0.32
59 0.32
60 0.29
61 0.27
62 0.24
63 0.19
64 0.2
65 0.18
66 0.18
67 0.13
68 0.11
69 0.1
70 0.09
71 0.08
72 0.09
73 0.1
74 0.08
75 0.09
76 0.1
77 0.16
78 0.26
79 0.37
80 0.45
81 0.54
82 0.63
83 0.72
84 0.8
85 0.85
86 0.85
87 0.83
88 0.84
89 0.84
90 0.84
91 0.83
92 0.76
93 0.71
94 0.68
95 0.61
96 0.58
97 0.57
98 0.53
99 0.55
100 0.63