Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JKH8

Protein Details
Accession A0A2H3JKH8    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
39-67VKPLGSASKPKPKPKPKPKPKPTQHPSAAHydrophilic
NLS Segment(s)
PositionSequence
45-60ASKPKPKPKPKPKPKP
Subcellular Location(s) cysk 10, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLLETEYINPNFVATLFVSQPPPPPRLFIRWLEVVEEPVKPLGSASKPKPKPKPKPKPKPTQHPSAAQRHTQMTSPLDSPAYSWTTKLGRQLLHPPSTKPLPPMRTVSSYGRKIISFFELRASWMYLAPETVQVVASYMRNRRGEFSFTRITAMRPMRLSSTDCAMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.12
3 0.13
4 0.15
5 0.17
6 0.18
7 0.26
8 0.28
9 0.3
10 0.27
11 0.3
12 0.32
13 0.37
14 0.41
15 0.37
16 0.39
17 0.4
18 0.39
19 0.38
20 0.34
21 0.31
22 0.27
23 0.23
24 0.18
25 0.15
26 0.14
27 0.11
28 0.11
29 0.13
30 0.16
31 0.24
32 0.3
33 0.39
34 0.46
35 0.55
36 0.66
37 0.72
38 0.78
39 0.82
40 0.87
41 0.88
42 0.92
43 0.94
44 0.95
45 0.93
46 0.93
47 0.88
48 0.86
49 0.8
50 0.77
51 0.74
52 0.72
53 0.66
54 0.57
55 0.54
56 0.46
57 0.42
58 0.34
59 0.3
60 0.21
61 0.2
62 0.18
63 0.16
64 0.14
65 0.13
66 0.12
67 0.12
68 0.13
69 0.11
70 0.1
71 0.12
72 0.14
73 0.15
74 0.19
75 0.2
76 0.18
77 0.2
78 0.29
79 0.32
80 0.36
81 0.36
82 0.33
83 0.34
84 0.36
85 0.34
86 0.31
87 0.32
88 0.3
89 0.32
90 0.35
91 0.34
92 0.35
93 0.38
94 0.4
95 0.42
96 0.41
97 0.4
98 0.37
99 0.34
100 0.31
101 0.29
102 0.27
103 0.21
104 0.19
105 0.2
106 0.19
107 0.2
108 0.21
109 0.2
110 0.15
111 0.15
112 0.15
113 0.12
114 0.12
115 0.11
116 0.11
117 0.1
118 0.1
119 0.09
120 0.08
121 0.09
122 0.1
123 0.12
124 0.16
125 0.2
126 0.27
127 0.3
128 0.32
129 0.35
130 0.37
131 0.41
132 0.4
133 0.42
134 0.41
135 0.38
136 0.4
137 0.37
138 0.35
139 0.37
140 0.38
141 0.37
142 0.33
143 0.34
144 0.35
145 0.37
146 0.39
147 0.33