Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JGT2

Protein Details
Accession A0A2H3JGT2    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
246-267RDLDRRPPLPRRDSPPPPRRDVBasic
271-294WDKGGRRGISRSRSPPRRRAPRYDBasic
NLS Segment(s)
PositionSequence
230-292PRGARGGGRGADIGRDRDLDRRPPLPRRDSPPPPRRDVRGDWDKGGRRGISRSRSPPRRRAPR
Subcellular Location(s) nucl 9cyto 9cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR010516  SAP18  
IPR042534  SAP18_sf  
Pfam View protein in Pfam  
PF06487  SAP18  
Amino Acid Sequences MEETTAAGRPIVDREKTAPFLIRTFIKIGSFHRPTQFEEGPLPLNDEQQIFTWKDATLREVLTTLRATAKALPEIRHPLARYSFRALYADSATRGRLTQKDLGIVYSRDILGEPGSLSTPAPRLLSDDDVPPGADERTLDELRFVPGDYLCVAVLLPKNATVAVGPGGELAIKGSAAPTPGASAANGWKNGGRGDGGWGGGAAASSGPPGGLGRGGGHWRGDSNPAQPVPRGARGGGRGADIGRDRDLDRRPPLPRRDSPPPPRRDVRGDWDKGGRRGISRSRSPPRRRAPRYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.38
4 0.39
5 0.38
6 0.34
7 0.34
8 0.35
9 0.34
10 0.3
11 0.3
12 0.29
13 0.26
14 0.26
15 0.28
16 0.34
17 0.36
18 0.38
19 0.42
20 0.43
21 0.44
22 0.5
23 0.48
24 0.41
25 0.38
26 0.36
27 0.33
28 0.31
29 0.31
30 0.24
31 0.23
32 0.22
33 0.21
34 0.19
35 0.17
36 0.22
37 0.18
38 0.18
39 0.18
40 0.16
41 0.18
42 0.18
43 0.19
44 0.18
45 0.17
46 0.17
47 0.16
48 0.16
49 0.16
50 0.16
51 0.14
52 0.14
53 0.14
54 0.14
55 0.17
56 0.19
57 0.22
58 0.25
59 0.25
60 0.28
61 0.35
62 0.36
63 0.37
64 0.35
65 0.33
66 0.37
67 0.4
68 0.38
69 0.37
70 0.36
71 0.33
72 0.34
73 0.29
74 0.25
75 0.24
76 0.22
77 0.17
78 0.16
79 0.16
80 0.15
81 0.16
82 0.16
83 0.16
84 0.2
85 0.23
86 0.23
87 0.26
88 0.25
89 0.26
90 0.25
91 0.23
92 0.19
93 0.15
94 0.14
95 0.11
96 0.11
97 0.09
98 0.07
99 0.07
100 0.07
101 0.06
102 0.06
103 0.06
104 0.06
105 0.07
106 0.08
107 0.09
108 0.09
109 0.08
110 0.11
111 0.12
112 0.15
113 0.15
114 0.15
115 0.14
116 0.14
117 0.14
118 0.11
119 0.1
120 0.07
121 0.07
122 0.05
123 0.07
124 0.13
125 0.13
126 0.13
127 0.13
128 0.13
129 0.14
130 0.14
131 0.12
132 0.07
133 0.07
134 0.08
135 0.07
136 0.07
137 0.06
138 0.06
139 0.05
140 0.07
141 0.08
142 0.08
143 0.07
144 0.07
145 0.07
146 0.07
147 0.08
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.04
156 0.04
157 0.04
158 0.03
159 0.03
160 0.03
161 0.03
162 0.04
163 0.05
164 0.05
165 0.05
166 0.06
167 0.06
168 0.07
169 0.07
170 0.07
171 0.1
172 0.14
173 0.14
174 0.14
175 0.14
176 0.15
177 0.15
178 0.15
179 0.11
180 0.08
181 0.11
182 0.12
183 0.11
184 0.1
185 0.1
186 0.09
187 0.08
188 0.08
189 0.04
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.04
198 0.04
199 0.05
200 0.06
201 0.08
202 0.11
203 0.12
204 0.13
205 0.13
206 0.14
207 0.15
208 0.19
209 0.19
210 0.19
211 0.24
212 0.25
213 0.26
214 0.25
215 0.3
216 0.3
217 0.32
218 0.31
219 0.26
220 0.29
221 0.3
222 0.34
223 0.29
224 0.25
225 0.22
226 0.2
227 0.24
228 0.22
229 0.22
230 0.19
231 0.2
232 0.2
233 0.26
234 0.31
235 0.34
236 0.37
237 0.42
238 0.48
239 0.55
240 0.64
241 0.66
242 0.69
243 0.69
244 0.74
245 0.77
246 0.81
247 0.82
248 0.8
249 0.79
250 0.78
251 0.76
252 0.74
253 0.7
254 0.69
255 0.7
256 0.67
257 0.63
258 0.66
259 0.67
260 0.63
261 0.62
262 0.55
263 0.47
264 0.51
265 0.55
266 0.55
267 0.57
268 0.64
269 0.69
270 0.77
271 0.82
272 0.85
273 0.87
274 0.89