Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3JJF4

Protein Details
Accession A0A2H3JJF4    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-29ASATKRNLSTVKKKRPRRIPPTLDAMSHydrophilic
NLS Segment(s)
PositionSequence
14-20KKKRPRR
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
Amino Acid Sequences MAASATKRNLSTVKKKRPRRIPPTLDAMSLRSARLLLCLWGFLVAAPGARTILACIRTQYTGGAYMFPQYYPALYSRGGSEWGSSIVGGHKIYAITSQPQADASRICCSVMGAAGTSSQDECMELSSGGERGLTLLEHSLSTLAVGAGYERNIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.79
3 0.86
4 0.9
5 0.92
6 0.91
7 0.91
8 0.89
9 0.85
10 0.84
11 0.75
12 0.66
13 0.56
14 0.48
15 0.42
16 0.34
17 0.27
18 0.18
19 0.17
20 0.14
21 0.15
22 0.13
23 0.1
24 0.1
25 0.1
26 0.09
27 0.09
28 0.09
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.09
40 0.11
41 0.11
42 0.12
43 0.13
44 0.14
45 0.14
46 0.14
47 0.11
48 0.12
49 0.12
50 0.12
51 0.1
52 0.12
53 0.11
54 0.11
55 0.11
56 0.08
57 0.08
58 0.08
59 0.09
60 0.09
61 0.09
62 0.1
63 0.09
64 0.1
65 0.11
66 0.1
67 0.09
68 0.08
69 0.08
70 0.08
71 0.07
72 0.07
73 0.06
74 0.08
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.08
81 0.08
82 0.09
83 0.11
84 0.11
85 0.11
86 0.12
87 0.13
88 0.13
89 0.14
90 0.14
91 0.15
92 0.15
93 0.15
94 0.13
95 0.13
96 0.12
97 0.11
98 0.1
99 0.07
100 0.06
101 0.07
102 0.07
103 0.08
104 0.07
105 0.07
106 0.07
107 0.07
108 0.07
109 0.07
110 0.08
111 0.08
112 0.08
113 0.09
114 0.09
115 0.09
116 0.09
117 0.07
118 0.06
119 0.07
120 0.07
121 0.06
122 0.08
123 0.08
124 0.08
125 0.09
126 0.09
127 0.08
128 0.08
129 0.07
130 0.06
131 0.05
132 0.05
133 0.06
134 0.07