Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3JWU9

Protein Details
Accession A0A2H3JWU9    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-25SVAKRAPDAPPEKRRPPRPSTHydrophilic
NLS Segment(s)
PositionSequence
8-24KRAPDAPPEKRRPPRPS
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences TSSKSVAKRAPDAPPEKRRPPRPSTDGSRSSPSKVAPRQSQPSRAASEIRGPTRPTLRANPYPEVTDLFCRLPLSTLFYQLEAVHLGDLLRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.71
3 0.75
4 0.79
5 0.81
6 0.8
7 0.8
8 0.8
9 0.76
10 0.75
11 0.74
12 0.73
13 0.7
14 0.65
15 0.64
16 0.56
17 0.52
18 0.46
19 0.4
20 0.39
21 0.38
22 0.41
23 0.41
24 0.46
25 0.52
26 0.54
27 0.58
28 0.53
29 0.52
30 0.48
31 0.42
32 0.37
33 0.29
34 0.32
35 0.29
36 0.27
37 0.26
38 0.24
39 0.26
40 0.29
41 0.31
42 0.28
43 0.3
44 0.36
45 0.41
46 0.44
47 0.45
48 0.43
49 0.42
50 0.39
51 0.34
52 0.28
53 0.24
54 0.22
55 0.18
56 0.18
57 0.17
58 0.16
59 0.16
60 0.15
61 0.19
62 0.18
63 0.23
64 0.22
65 0.22
66 0.24
67 0.22
68 0.22
69 0.16
70 0.16
71 0.1
72 0.1