Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JCS3

Protein Details
Accession A0A2H3JCS3    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-37HPAGSLRQRQRPRTSGRPNGKGNRPSHHydrophilic
192-212VSEGHNRKKAKKANLWERNAHHydrophilic
NLS Segment(s)
PositionSequence
174-204GQRRRHRLSSKGGGQGNKVSEGHNRKKAKKA
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MAAGHPSPYAHPAGSLRQRQRPRTSGRPNGKGNRPSHSTQPQATATDPPAYQTQWRAKAHSRQGNPPHTESNGSAVCLNNRATPSADRALTGRAAGTPQGSEAASDAQSPASIRSAGSQRSSATPNPEYPAKVLTRGGGGIIKSPFQQFSQESESDAQRSRLRTHRQTAIDPPGQRRRHRLSSKGGGQGNKVSEGHNRKKAKKANLWERNAHVGLGQPRTRHHAQSGRSGHPSVTVPLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.44
3 0.49
4 0.56
5 0.65
6 0.71
7 0.78
8 0.77
9 0.77
10 0.78
11 0.81
12 0.82
13 0.84
14 0.84
15 0.84
16 0.85
17 0.85
18 0.83
19 0.76
20 0.72
21 0.67
22 0.62
23 0.61
24 0.6
25 0.57
26 0.5
27 0.53
28 0.48
29 0.45
30 0.43
31 0.37
32 0.31
33 0.29
34 0.26
35 0.23
36 0.22
37 0.21
38 0.22
39 0.26
40 0.32
41 0.37
42 0.39
43 0.42
44 0.47
45 0.55
46 0.63
47 0.64
48 0.6
49 0.61
50 0.68
51 0.72
52 0.69
53 0.63
54 0.56
55 0.49
56 0.48
57 0.38
58 0.35
59 0.27
60 0.23
61 0.21
62 0.18
63 0.17
64 0.18
65 0.18
66 0.15
67 0.15
68 0.16
69 0.17
70 0.17
71 0.21
72 0.21
73 0.2
74 0.18
75 0.18
76 0.19
77 0.17
78 0.16
79 0.11
80 0.08
81 0.08
82 0.08
83 0.08
84 0.06
85 0.06
86 0.07
87 0.07
88 0.06
89 0.06
90 0.07
91 0.07
92 0.07
93 0.07
94 0.06
95 0.06
96 0.06
97 0.07
98 0.06
99 0.06
100 0.06
101 0.08
102 0.11
103 0.13
104 0.14
105 0.14
106 0.14
107 0.16
108 0.19
109 0.18
110 0.2
111 0.2
112 0.2
113 0.22
114 0.22
115 0.21
116 0.19
117 0.21
118 0.16
119 0.16
120 0.15
121 0.14
122 0.13
123 0.12
124 0.12
125 0.1
126 0.09
127 0.11
128 0.11
129 0.11
130 0.12
131 0.13
132 0.13
133 0.12
134 0.16
135 0.14
136 0.18
137 0.22
138 0.21
139 0.22
140 0.23
141 0.24
142 0.23
143 0.23
144 0.22
145 0.2
146 0.23
147 0.26
148 0.33
149 0.4
150 0.45
151 0.5
152 0.55
153 0.55
154 0.56
155 0.58
156 0.58
157 0.55
158 0.5
159 0.52
160 0.54
161 0.57
162 0.57
163 0.59
164 0.59
165 0.64
166 0.68
167 0.68
168 0.67
169 0.7
170 0.74
171 0.73
172 0.69
173 0.6
174 0.55
175 0.52
176 0.45
177 0.38
178 0.32
179 0.26
180 0.3
181 0.38
182 0.44
183 0.49
184 0.56
185 0.58
186 0.67
187 0.74
188 0.76
189 0.76
190 0.78
191 0.8
192 0.82
193 0.83
194 0.79
195 0.75
196 0.72
197 0.62
198 0.51
199 0.41
200 0.36
201 0.36
202 0.38
203 0.37
204 0.31
205 0.33
206 0.41
207 0.45
208 0.43
209 0.45
210 0.45
211 0.46
212 0.54
213 0.59
214 0.58
215 0.58
216 0.55
217 0.46
218 0.43
219 0.41