Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JLG5

Protein Details
Accession A0A2H3JLG5    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21DAQPKKRQRRRKDTAPVVYDIHydrophilic
NLS Segment(s)
PositionSequence
5-12KKRQRRRK
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, mito 9, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004601  UvdE  
IPR036237  Xyl_isomerase-like_sf  
Gene Ontology GO:0004519  F:endonuclease activity  
GO:0006289  P:nucleotide-excision repair  
GO:0009411  P:response to UV  
Pfam View protein in Pfam  
PF03851  UvdE  
Amino Acid Sequences DAQPKKRQRRRKDTAPVVYDILPVERKQTNFTGHLGYACLNTILRARKPEPVFCSRTCRLDTIKKNGIEFAKELGRRNVQDLLEVIQWNEDNQIRFFRVSSEMFPFASHKVHGYDLDYCKGELKAAGDLARKYGHRLTTHPGQFTQLASPRDEVVDASVRELEYHCQMMRHMELDRDSVIIIHMGGVYGDKEGALARFRENYRTRLTDEMKARLVLENDEMCYSPDDLLPVCDELGIPMVLDYHHNWINPSVHPVAELLPRVAATWARKGIRQKQHLSEPRPGAETVMEKRAHADRCVALPPELTGGDVDLMIEAKDKEQAVFHLYRIYGLAPVVHENLRPEKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.87
3 0.79
4 0.71
5 0.62
6 0.52
7 0.41
8 0.34
9 0.27
10 0.22
11 0.24
12 0.25
13 0.26
14 0.29
15 0.33
16 0.35
17 0.35
18 0.37
19 0.36
20 0.33
21 0.32
22 0.29
23 0.24
24 0.19
25 0.17
26 0.16
27 0.11
28 0.11
29 0.16
30 0.21
31 0.24
32 0.31
33 0.32
34 0.4
35 0.45
36 0.51
37 0.52
38 0.55
39 0.57
40 0.53
41 0.6
42 0.54
43 0.56
44 0.51
45 0.48
46 0.46
47 0.51
48 0.55
49 0.56
50 0.61
51 0.57
52 0.56
53 0.56
54 0.52
55 0.44
56 0.37
57 0.32
58 0.31
59 0.32
60 0.34
61 0.35
62 0.38
63 0.36
64 0.38
65 0.4
66 0.33
67 0.31
68 0.29
69 0.26
70 0.23
71 0.22
72 0.19
73 0.15
74 0.15
75 0.13
76 0.16
77 0.15
78 0.14
79 0.15
80 0.18
81 0.18
82 0.19
83 0.19
84 0.18
85 0.2
86 0.2
87 0.21
88 0.23
89 0.22
90 0.22
91 0.23
92 0.22
93 0.19
94 0.19
95 0.17
96 0.14
97 0.14
98 0.15
99 0.15
100 0.16
101 0.21
102 0.22
103 0.24
104 0.23
105 0.21
106 0.22
107 0.21
108 0.19
109 0.13
110 0.12
111 0.1
112 0.11
113 0.14
114 0.15
115 0.15
116 0.17
117 0.18
118 0.17
119 0.19
120 0.22
121 0.23
122 0.23
123 0.25
124 0.29
125 0.36
126 0.39
127 0.37
128 0.34
129 0.31
130 0.3
131 0.28
132 0.26
133 0.23
134 0.21
135 0.2
136 0.21
137 0.19
138 0.18
139 0.18
140 0.13
141 0.1
142 0.12
143 0.11
144 0.11
145 0.11
146 0.11
147 0.11
148 0.12
149 0.11
150 0.09
151 0.1
152 0.1
153 0.09
154 0.1
155 0.11
156 0.12
157 0.12
158 0.11
159 0.11
160 0.11
161 0.12
162 0.12
163 0.1
164 0.09
165 0.08
166 0.07
167 0.06
168 0.05
169 0.04
170 0.04
171 0.03
172 0.03
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.04
180 0.05
181 0.06
182 0.07
183 0.08
184 0.13
185 0.14
186 0.23
187 0.25
188 0.28
189 0.32
190 0.34
191 0.35
192 0.37
193 0.4
194 0.38
195 0.39
196 0.39
197 0.36
198 0.33
199 0.32
200 0.27
201 0.24
202 0.18
203 0.17
204 0.14
205 0.14
206 0.14
207 0.13
208 0.12
209 0.12
210 0.12
211 0.1
212 0.09
213 0.09
214 0.09
215 0.09
216 0.09
217 0.08
218 0.08
219 0.07
220 0.06
221 0.06
222 0.07
223 0.06
224 0.05
225 0.05
226 0.05
227 0.05
228 0.07
229 0.08
230 0.11
231 0.13
232 0.14
233 0.15
234 0.18
235 0.21
236 0.2
237 0.23
238 0.2
239 0.18
240 0.18
241 0.18
242 0.17
243 0.18
244 0.18
245 0.13
246 0.13
247 0.13
248 0.13
249 0.13
250 0.14
251 0.14
252 0.19
253 0.25
254 0.26
255 0.3
256 0.38
257 0.48
258 0.54
259 0.6
260 0.61
261 0.62
262 0.72
263 0.77
264 0.74
265 0.72
266 0.67
267 0.61
268 0.56
269 0.49
270 0.39
271 0.33
272 0.34
273 0.28
274 0.31
275 0.29
276 0.26
277 0.3
278 0.35
279 0.36
280 0.31
281 0.33
282 0.27
283 0.3
284 0.34
285 0.33
286 0.27
287 0.25
288 0.24
289 0.22
290 0.19
291 0.17
292 0.12
293 0.11
294 0.1
295 0.1
296 0.09
297 0.06
298 0.06
299 0.06
300 0.08
301 0.08
302 0.08
303 0.12
304 0.13
305 0.13
306 0.14
307 0.16
308 0.21
309 0.22
310 0.23
311 0.24
312 0.24
313 0.24
314 0.23
315 0.22
316 0.17
317 0.15
318 0.16
319 0.13
320 0.16
321 0.18
322 0.19
323 0.2
324 0.23