Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3JJ48

Protein Details
Accession A0A2H3JJ48    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-36SSGGGKAAKKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
11-30SGGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAPTSSGGGKAAKKKKWSKGKVKDKAQHAVILDKPTYDRIMKEVPTFRFISQSILIERLKINGSLARVAIRHLEKEGQIKQIVHHSSQLIYTRSTGGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.37
3 0.42
4 0.44
5 0.53
6 0.59
7 0.68
8 0.75
9 0.8
10 0.81
11 0.84
12 0.89
13 0.9
14 0.91
15 0.88
16 0.84
17 0.8
18 0.71
19 0.63
20 0.53
21 0.47
22 0.4
23 0.35
24 0.29
25 0.22
26 0.21
27 0.19
28 0.2
29 0.16
30 0.14
31 0.14
32 0.17
33 0.18
34 0.22
35 0.26
36 0.25
37 0.27
38 0.29
39 0.25
40 0.24
41 0.23
42 0.22
43 0.18
44 0.18
45 0.15
46 0.17
47 0.17
48 0.16
49 0.16
50 0.14
51 0.14
52 0.12
53 0.13
54 0.11
55 0.12
56 0.12
57 0.13
58 0.13
59 0.12
60 0.13
61 0.17
62 0.17
63 0.17
64 0.18
65 0.2
66 0.21
67 0.28
68 0.3
69 0.29
70 0.31
71 0.3
72 0.3
73 0.36
74 0.37
75 0.31
76 0.32
77 0.28
78 0.26
79 0.29
80 0.33
81 0.26
82 0.24
83 0.24
84 0.23