Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3IUP9

Protein Details
Accession A0A2H3IUP9    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-27RFKTDPRFRKIRKEESKVVLBasic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039754  Esf1  
Gene Ontology GO:0006364  P:rRNA processing  
Amino Acid Sequences MSDPRFARFKTDPRFRKIRKEESKVVLDERFKSVLEGDNKQKGKGRVDKYGRSLADTHEKDNLRRFYRLENEEEEKDEPEPSLGPDYALLYHSPPSDMTVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.74
3 0.78
4 0.78
5 0.79
6 0.79
7 0.8
8 0.8
9 0.76
10 0.77
11 0.68
12 0.62
13 0.55
14 0.48
15 0.42
16 0.37
17 0.31
18 0.25
19 0.23
20 0.21
21 0.22
22 0.23
23 0.26
24 0.27
25 0.35
26 0.35
27 0.36
28 0.4
29 0.37
30 0.4
31 0.44
32 0.43
33 0.45
34 0.5
35 0.53
36 0.52
37 0.55
38 0.48
39 0.41
40 0.37
41 0.3
42 0.34
43 0.31
44 0.28
45 0.28
46 0.29
47 0.29
48 0.37
49 0.41
50 0.35
51 0.36
52 0.36
53 0.36
54 0.43
55 0.45
56 0.41
57 0.39
58 0.41
59 0.4
60 0.41
61 0.36
62 0.29
63 0.26
64 0.23
65 0.17
66 0.13
67 0.13
68 0.12
69 0.14
70 0.13
71 0.12
72 0.13
73 0.14
74 0.14
75 0.14
76 0.13
77 0.11
78 0.14
79 0.14
80 0.14
81 0.14