Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JR09

Protein Details
Accession A0A2H3JR09    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
79-107IDHARVKALKKKRSTPRRKTVTQDAPRVEHydrophilic
NLS Segment(s)
PositionSequence
84-97VKALKKKRSTPRRK
Subcellular Location(s) cyto_nucl 11.5, cyto 11, nucl 10, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
IPR018506  Cyt_B5_heme-BS  
Gene Ontology GO:0020037  F:heme binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
PROSITE View protein in PROSITE  
PS00191  CYTOCHROME_B5_1  
PS50255  CYTOCHROME_B5_2  
Amino Acid Sequences MSDRTWTPQEVAKHNKPDDCWVIVSGKVYDVTEFLPNHPGGVRLLLNFAGRDATSAFKPFHTPTALTDALPSEKYLGSIDHARVKALKKKRSTPRRKTVTQDAPRVEVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.57
4 0.58
5 0.53
6 0.46
7 0.39
8 0.32
9 0.3
10 0.27
11 0.26
12 0.19
13 0.16
14 0.14
15 0.13
16 0.11
17 0.1
18 0.11
19 0.14
20 0.14
21 0.14
22 0.18
23 0.17
24 0.18
25 0.17
26 0.16
27 0.12
28 0.14
29 0.13
30 0.09
31 0.1
32 0.11
33 0.11
34 0.1
35 0.09
36 0.08
37 0.07
38 0.07
39 0.07
40 0.07
41 0.08
42 0.1
43 0.1
44 0.1
45 0.13
46 0.13
47 0.15
48 0.15
49 0.15
50 0.15
51 0.21
52 0.21
53 0.18
54 0.18
55 0.17
56 0.16
57 0.16
58 0.15
59 0.1
60 0.09
61 0.1
62 0.1
63 0.09
64 0.11
65 0.14
66 0.17
67 0.22
68 0.22
69 0.22
70 0.25
71 0.31
72 0.37
73 0.42
74 0.48
75 0.49
76 0.59
77 0.7
78 0.77
79 0.83
80 0.85
81 0.87
82 0.88
83 0.87
84 0.85
85 0.85
86 0.85
87 0.83
88 0.81
89 0.74
90 0.68