Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AQR4

Protein Details
Accession G3AQR4   
Localization Confidence High
Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKSLRSKSKLRAKSVKRKGEFTKHydrophilic
74-100STSGWRDSRKQIYKQRQLKKKGKSLKFHydrophilic
NLS Segment(s)
PositionSequence
6-20RSKSKLRAKSVKRKG
86-99YKQRQLKKKGKSLK
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG spaa:SPAPADRAFT_51604  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKSKLRAKSVKRKGEFTKFVDSRNTRIAKKLEQETKKQDEAKKETTEDEAPVEPTMEVDEEKSEKKVSTSGWRDSRKQIYKQRQLKKKGKSLKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.87
3 0.87
4 0.81
5 0.8
6 0.79
7 0.79
8 0.76
9 0.69
10 0.7
11 0.6
12 0.59
13 0.6
14 0.54
15 0.48
16 0.49
17 0.49
18 0.39
19 0.43
20 0.45
21 0.4
22 0.44
23 0.49
24 0.49
25 0.49
26 0.55
27 0.57
28 0.59
29 0.58
30 0.57
31 0.53
32 0.52
33 0.54
34 0.52
35 0.47
36 0.42
37 0.38
38 0.36
39 0.33
40 0.25
41 0.21
42 0.16
43 0.14
44 0.13
45 0.12
46 0.09
47 0.08
48 0.08
49 0.06
50 0.06
51 0.06
52 0.07
53 0.09
54 0.1
55 0.12
56 0.12
57 0.12
58 0.13
59 0.15
60 0.17
61 0.25
62 0.31
63 0.38
64 0.46
65 0.51
66 0.55
67 0.6
68 0.67
69 0.65
70 0.69
71 0.71
72 0.73
73 0.78
74 0.84
75 0.86
76 0.86
77 0.88
78 0.88
79 0.88
80 0.87