Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3JFU4

Protein Details
Accession A0A2H3JFU4    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-34FESLPCPEKHNCRRVKCLFNHRPGAKEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 11, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013520  Exonuclease_RNaseT/DNA_pol3  
IPR034922  REX1-like_exo  
IPR047021  REXO1/3/4-like  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0004527  F:exonuclease activity  
GO:0003676  F:nucleic acid binding  
CDD cd06145  REX1_like  
Amino Acid Sequences MFSTVGLFESLPCPEKHNCRRVKCLFNHRPGAKEVHTLHIPVEQPAAPAPPATAPVASSSTSGTQRSQIPAQKAASSVPAKRPLSYAQVSSPNRTKEASNEPPRKLQRTGPPTVATGVPTAAPTSTGCPVLRVSAAHSYAPIPVRQSMLKNLYDHFCVLYKAILPTNPTLASEHSLRQEEEVYKRSNKHTYRNAVISSIAALKRRAFPDSASHASVGTEGDLAARAEAAQKFATLRLTRAQLVPYVLSLDDMRRFGYVVEVPPGEGGAQPADEGAVKTCERCAQPFMVKRKEEADECVYHWGKAFSNKVNGEKRRLYTCCSRPSESEGCERGPHVFYESAPEDLHRRHPFSYSHGRGTDTTLDVVALDCEMVYTTGGMRVARVSVVDAAGKEIFDEFVRMDDGVEVIDFNTRFSGITPELYASARLPLASVRASLDTLIGARTVIIGHALENDLKTLRMIHHCCVDTAVLFPHPSGPPYRRALRTLAKEFLGKTIQSGGGTVGHSSVEDSIATLDLVRWHVLNRPPPPPPKAKAPAPEVIDVDAML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.39
3 0.48
4 0.55
5 0.62
6 0.66
7 0.76
8 0.81
9 0.84
10 0.83
11 0.84
12 0.85
13 0.84
14 0.87
15 0.8
16 0.75
17 0.69
18 0.66
19 0.57
20 0.56
21 0.48
22 0.45
23 0.43
24 0.4
25 0.37
26 0.35
27 0.33
28 0.25
29 0.27
30 0.2
31 0.19
32 0.2
33 0.21
34 0.16
35 0.15
36 0.15
37 0.13
38 0.15
39 0.15
40 0.14
41 0.12
42 0.15
43 0.17
44 0.16
45 0.16
46 0.15
47 0.18
48 0.21
49 0.23
50 0.22
51 0.24
52 0.27
53 0.31
54 0.37
55 0.39
56 0.4
57 0.45
58 0.45
59 0.43
60 0.4
61 0.36
62 0.37
63 0.35
64 0.35
65 0.37
66 0.44
67 0.43
68 0.43
69 0.45
70 0.41
71 0.44
72 0.42
73 0.37
74 0.33
75 0.42
76 0.43
77 0.47
78 0.5
79 0.45
80 0.44
81 0.43
82 0.39
83 0.35
84 0.43
85 0.47
86 0.51
87 0.56
88 0.58
89 0.66
90 0.71
91 0.7
92 0.63
93 0.6
94 0.6
95 0.59
96 0.61
97 0.57
98 0.53
99 0.48
100 0.47
101 0.4
102 0.3
103 0.23
104 0.18
105 0.13
106 0.12
107 0.11
108 0.09
109 0.09
110 0.08
111 0.11
112 0.12
113 0.15
114 0.14
115 0.15
116 0.16
117 0.17
118 0.17
119 0.14
120 0.16
121 0.19
122 0.21
123 0.19
124 0.19
125 0.18
126 0.21
127 0.23
128 0.2
129 0.16
130 0.16
131 0.19
132 0.21
133 0.22
134 0.26
135 0.29
136 0.31
137 0.31
138 0.31
139 0.31
140 0.3
141 0.28
142 0.22
143 0.18
144 0.15
145 0.14
146 0.13
147 0.12
148 0.13
149 0.14
150 0.14
151 0.15
152 0.16
153 0.18
154 0.18
155 0.17
156 0.16
157 0.16
158 0.17
159 0.17
160 0.18
161 0.19
162 0.21
163 0.2
164 0.2
165 0.22
166 0.23
167 0.26
168 0.28
169 0.29
170 0.31
171 0.35
172 0.38
173 0.44
174 0.45
175 0.49
176 0.54
177 0.57
178 0.57
179 0.58
180 0.54
181 0.45
182 0.41
183 0.32
184 0.24
185 0.22
186 0.18
187 0.15
188 0.16
189 0.17
190 0.22
191 0.23
192 0.24
193 0.2
194 0.2
195 0.25
196 0.31
197 0.32
198 0.28
199 0.27
200 0.25
201 0.24
202 0.23
203 0.16
204 0.09
205 0.06
206 0.05
207 0.05
208 0.05
209 0.05
210 0.04
211 0.04
212 0.04
213 0.07
214 0.08
215 0.09
216 0.09
217 0.09
218 0.1
219 0.11
220 0.16
221 0.13
222 0.14
223 0.16
224 0.18
225 0.19
226 0.2
227 0.2
228 0.16
229 0.17
230 0.15
231 0.12
232 0.1
233 0.09
234 0.08
235 0.08
236 0.08
237 0.09
238 0.1
239 0.1
240 0.09
241 0.09
242 0.09
243 0.11
244 0.11
245 0.1
246 0.11
247 0.11
248 0.11
249 0.1
250 0.1
251 0.08
252 0.06
253 0.06
254 0.04
255 0.04
256 0.04
257 0.04
258 0.04
259 0.04
260 0.04
261 0.04
262 0.07
263 0.07
264 0.07
265 0.08
266 0.12
267 0.12
268 0.14
269 0.15
270 0.16
271 0.23
272 0.3
273 0.37
274 0.41
275 0.41
276 0.4
277 0.42
278 0.41
279 0.35
280 0.32
281 0.29
282 0.23
283 0.23
284 0.29
285 0.26
286 0.23
287 0.23
288 0.2
289 0.17
290 0.21
291 0.24
292 0.19
293 0.26
294 0.28
295 0.35
296 0.42
297 0.44
298 0.45
299 0.46
300 0.46
301 0.46
302 0.46
303 0.43
304 0.44
305 0.48
306 0.51
307 0.51
308 0.51
309 0.45
310 0.51
311 0.51
312 0.44
313 0.43
314 0.36
315 0.32
316 0.31
317 0.3
318 0.25
319 0.21
320 0.19
321 0.15
322 0.14
323 0.13
324 0.18
325 0.18
326 0.17
327 0.16
328 0.17
329 0.17
330 0.18
331 0.27
332 0.25
333 0.26
334 0.26
335 0.29
336 0.3
337 0.35
338 0.44
339 0.39
340 0.41
341 0.39
342 0.4
343 0.37
344 0.39
345 0.35
346 0.25
347 0.21
348 0.16
349 0.15
350 0.13
351 0.12
352 0.08
353 0.05
354 0.04
355 0.03
356 0.03
357 0.03
358 0.04
359 0.03
360 0.04
361 0.04
362 0.06
363 0.07
364 0.07
365 0.07
366 0.08
367 0.08
368 0.08
369 0.08
370 0.07
371 0.07
372 0.08
373 0.09
374 0.08
375 0.1
376 0.1
377 0.1
378 0.09
379 0.08
380 0.08
381 0.07
382 0.08
383 0.06
384 0.07
385 0.08
386 0.08
387 0.08
388 0.07
389 0.07
390 0.06
391 0.06
392 0.05
393 0.05
394 0.08
395 0.08
396 0.08
397 0.09
398 0.09
399 0.09
400 0.1
401 0.15
402 0.12
403 0.14
404 0.14
405 0.14
406 0.16
407 0.16
408 0.16
409 0.12
410 0.13
411 0.11
412 0.1
413 0.1
414 0.09
415 0.11
416 0.11
417 0.11
418 0.11
419 0.12
420 0.12
421 0.12
422 0.12
423 0.1
424 0.09
425 0.09
426 0.07
427 0.06
428 0.06
429 0.06
430 0.06
431 0.05
432 0.06
433 0.06
434 0.06
435 0.07
436 0.09
437 0.1
438 0.1
439 0.11
440 0.11
441 0.11
442 0.11
443 0.11
444 0.15
445 0.23
446 0.27
447 0.28
448 0.35
449 0.36
450 0.36
451 0.35
452 0.32
453 0.23
454 0.21
455 0.2
456 0.15
457 0.15
458 0.14
459 0.18
460 0.18
461 0.19
462 0.24
463 0.25
464 0.3
465 0.37
466 0.45
467 0.44
468 0.46
469 0.52
470 0.55
471 0.61
472 0.6
473 0.57
474 0.51
475 0.5
476 0.47
477 0.45
478 0.4
479 0.3
480 0.25
481 0.26
482 0.25
483 0.22
484 0.22
485 0.18
486 0.17
487 0.18
488 0.17
489 0.13
490 0.11
491 0.11
492 0.11
493 0.11
494 0.08
495 0.08
496 0.08
497 0.08
498 0.08
499 0.08
500 0.08
501 0.08
502 0.1
503 0.12
504 0.13
505 0.13
506 0.14
507 0.21
508 0.28
509 0.35
510 0.39
511 0.44
512 0.51
513 0.59
514 0.65
515 0.67
516 0.65
517 0.67
518 0.69
519 0.7
520 0.7
521 0.69
522 0.68
523 0.64
524 0.63
525 0.53
526 0.47