Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3JGQ6

Protein Details
Accession A0A2H3JGQ6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
39-59WDNWNKGKQWKDIRHKYVQEEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, golg 4, mito 2, cyto 1, plas 1, pero 1, E.R. 1, vacu 1, mito_nucl 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences LANTFYNTIVKRNSVFVSTIFAGAFAFGVSFDVGITKFWDNWNKGKQWKDIRHKYVQEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.2
4 0.22
5 0.19
6 0.19
7 0.15
8 0.13
9 0.11
10 0.1
11 0.1
12 0.04
13 0.04
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.04
20 0.04
21 0.05
22 0.07
23 0.07
24 0.08
25 0.12
26 0.2
27 0.23
28 0.3
29 0.36
30 0.4
31 0.46
32 0.51
33 0.56
34 0.6
35 0.67
36 0.71
37 0.76
38 0.77
39 0.81