Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3J370

Protein Details
Accession A0A2H3J370    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-27EKNGWGPRHRHRHVRHTVRIBasic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 8, mito_nucl 8
Family & Domain DBs
Amino Acid Sequences MSPCEVVEKNGWGPRHRHRHVRHTVRIGVRNTRWLGFRQRCQTAPYLRAHLAALERGNVGLKRRRSYFAFAYRSLGTCLARW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.54
3 0.56
4 0.61
5 0.63
6 0.71
7 0.78
8 0.81
9 0.8
10 0.76
11 0.77
12 0.74
13 0.73
14 0.66
15 0.62
16 0.54
17 0.52
18 0.46
19 0.41
20 0.35
21 0.32
22 0.39
23 0.37
24 0.42
25 0.42
26 0.43
27 0.43
28 0.43
29 0.46
30 0.4
31 0.38
32 0.34
33 0.32
34 0.29
35 0.29
36 0.27
37 0.23
38 0.19
39 0.17
40 0.15
41 0.11
42 0.11
43 0.1
44 0.13
45 0.13
46 0.17
47 0.22
48 0.27
49 0.32
50 0.35
51 0.4
52 0.42
53 0.47
54 0.51
55 0.54
56 0.54
57 0.5
58 0.51
59 0.48
60 0.45
61 0.41
62 0.35