Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3JIA5

Protein Details
Accession A0A2H3JIA5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHRNGIKKPQTHHydrophilic
NLS Segment(s)
PositionSequence
14-55KKAHRNGIKKPQTHRQRSMRGVDPKFRRNAKFARRGSKGRPG
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPQTHRQRSMRGVDPKFRRNAKFARRGSKGRPGAEGGEGIVMMC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.8
6 0.8
7 0.83
8 0.82
9 0.78
10 0.75
11 0.75
12 0.76
13 0.75
14 0.75
15 0.73
16 0.73
17 0.72
18 0.72
19 0.7
20 0.68
21 0.63
22 0.62
23 0.59
24 0.57
25 0.58
26 0.59
27 0.53
28 0.5
29 0.57
30 0.58
31 0.62
32 0.63
33 0.66
34 0.66
35 0.7
36 0.7
37 0.71
38 0.69
39 0.61
40 0.57
41 0.51
42 0.46
43 0.42
44 0.36
45 0.26
46 0.19