Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3J972

Protein Details
Accession A0A2H3J972    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
288-313RGYDRHSSRYDERRRDRSRSPGRRRYBasic
NLS Segment(s)
PositionSequence
300-313RRRDRSRSPGRRRY
Subcellular Location(s) nucl 12, cyto_nucl 11, cyto 8, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004882  Luc7-rel  
Gene Ontology GO:0005685  C:U1 snRNP  
GO:0003729  F:mRNA binding  
GO:0006376  P:mRNA splice site selection  
Pfam View protein in Pfam  
PF03194  LUC7  
Amino Acid Sequences MGRLAEMQRKLLEQMMGPEAMGVANANLTWSDEKVCRNFLCGTCPHTLFTNTKMDLGACPKSHTERLKTEYLQAKEANPNDPIFARFQMEYESNIFAFVDECDRRIRAAHRRLEKTPEENAKTTNLMREIAEIELAIQGGTEKIETLGEQGKVDESMREMAAIEALKSEKADKERELQQLTDTSGASGHQKLRVCDVCGAYLSVLDSDRRLADHFGGKMHLGYHELRNMLIKFKEEREKRKMAPPSSVPAAGSGSGGIPPAPSGVPPRGGDRDYRSSRDDFRDRERDRGYDRHSSRYDERRRDRSRSPGRRRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.23
4 0.21
5 0.19
6 0.15
7 0.13
8 0.12
9 0.07
10 0.04
11 0.05
12 0.05
13 0.05
14 0.05
15 0.08
16 0.09
17 0.1
18 0.13
19 0.17
20 0.22
21 0.25
22 0.31
23 0.29
24 0.31
25 0.36
26 0.34
27 0.37
28 0.35
29 0.36
30 0.36
31 0.36
32 0.34
33 0.31
34 0.34
35 0.3
36 0.32
37 0.35
38 0.3
39 0.3
40 0.29
41 0.27
42 0.26
43 0.29
44 0.3
45 0.23
46 0.25
47 0.27
48 0.31
49 0.38
50 0.41
51 0.42
52 0.44
53 0.48
54 0.53
55 0.51
56 0.54
57 0.54
58 0.5
59 0.48
60 0.42
61 0.4
62 0.41
63 0.42
64 0.37
65 0.31
66 0.29
67 0.26
68 0.25
69 0.23
70 0.19
71 0.18
72 0.17
73 0.15
74 0.15
75 0.17
76 0.17
77 0.17
78 0.17
79 0.17
80 0.14
81 0.14
82 0.14
83 0.11
84 0.1
85 0.08
86 0.12
87 0.11
88 0.13
89 0.14
90 0.15
91 0.15
92 0.18
93 0.24
94 0.28
95 0.37
96 0.44
97 0.51
98 0.56
99 0.58
100 0.62
101 0.6
102 0.54
103 0.53
104 0.53
105 0.48
106 0.44
107 0.42
108 0.37
109 0.35
110 0.31
111 0.27
112 0.2
113 0.17
114 0.16
115 0.16
116 0.15
117 0.12
118 0.12
119 0.08
120 0.07
121 0.06
122 0.06
123 0.05
124 0.03
125 0.03
126 0.03
127 0.04
128 0.03
129 0.03
130 0.03
131 0.04
132 0.04
133 0.06
134 0.09
135 0.09
136 0.09
137 0.09
138 0.09
139 0.1
140 0.1
141 0.08
142 0.06
143 0.07
144 0.07
145 0.07
146 0.07
147 0.06
148 0.07
149 0.07
150 0.06
151 0.05
152 0.06
153 0.06
154 0.06
155 0.07
156 0.09
157 0.12
158 0.15
159 0.16
160 0.2
161 0.27
162 0.32
163 0.33
164 0.3
165 0.29
166 0.27
167 0.27
168 0.23
169 0.16
170 0.11
171 0.1
172 0.1
173 0.1
174 0.11
175 0.12
176 0.15
177 0.18
178 0.18
179 0.24
180 0.26
181 0.26
182 0.27
183 0.26
184 0.23
185 0.21
186 0.21
187 0.15
188 0.12
189 0.11
190 0.08
191 0.07
192 0.07
193 0.07
194 0.07
195 0.08
196 0.08
197 0.09
198 0.1
199 0.12
200 0.16
201 0.17
202 0.16
203 0.17
204 0.17
205 0.16
206 0.15
207 0.13
208 0.12
209 0.13
210 0.15
211 0.17
212 0.17
213 0.17
214 0.21
215 0.21
216 0.23
217 0.21
218 0.22
219 0.22
220 0.27
221 0.37
222 0.4
223 0.48
224 0.52
225 0.59
226 0.6
227 0.65
228 0.69
229 0.62
230 0.63
231 0.58
232 0.56
233 0.52
234 0.49
235 0.4
236 0.32
237 0.3
238 0.23
239 0.19
240 0.13
241 0.09
242 0.08
243 0.09
244 0.07
245 0.06
246 0.06
247 0.07
248 0.07
249 0.08
250 0.12
251 0.15
252 0.19
253 0.21
254 0.26
255 0.29
256 0.31
257 0.35
258 0.37
259 0.45
260 0.46
261 0.49
262 0.48
263 0.48
264 0.53
265 0.57
266 0.58
267 0.53
268 0.57
269 0.63
270 0.62
271 0.67
272 0.65
273 0.62
274 0.6
275 0.63
276 0.6
277 0.6
278 0.61
279 0.61
280 0.6
281 0.6
282 0.63
283 0.65
284 0.69
285 0.69
286 0.76
287 0.77
288 0.82
289 0.83
290 0.82
291 0.83
292 0.84
293 0.84