Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BVX7

Protein Details
Accession G8BVX7    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
176-203LESERLRKAEKKQNKKQQKKREEEWGEDBasic
NLS Segment(s)
PositionSequence
181-196LRKAEKKQNKKQQKKR
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR039730  Jlp2/Ccd25  
IPR008532  NFACT_RNA-bd  
KEGG tpf:TPHA_0G02190  -  
Pfam View protein in Pfam  
PF05670  NFACT-R_1  
Amino Acid Sequences MVYFYTSQPFPDSIPHQIIVGKDKFENDLLIKYGYRELNYTWFHADNYSSGHVYLKLLEKENSVSDVSSEIVNDCLQLCKSESIQGNKLPQCSILITPWHNLRKNRFMKPGEVSFKSQRACTKRDCFARDTKIMNRLNKTRVELYEDVENILHDAKKSKNPNYFTELIANQRDELLESERLRKAEKKQNKKQQKKREEEWGEDIDSDEISKLAAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.29
4 0.3
5 0.31
6 0.32
7 0.3
8 0.26
9 0.24
10 0.25
11 0.26
12 0.25
13 0.26
14 0.2
15 0.2
16 0.2
17 0.21
18 0.2
19 0.19
20 0.24
21 0.22
22 0.21
23 0.2
24 0.2
25 0.26
26 0.28
27 0.29
28 0.27
29 0.25
30 0.25
31 0.24
32 0.23
33 0.17
34 0.18
35 0.18
36 0.15
37 0.15
38 0.15
39 0.15
40 0.14
41 0.16
42 0.18
43 0.19
44 0.21
45 0.22
46 0.22
47 0.23
48 0.23
49 0.23
50 0.17
51 0.14
52 0.12
53 0.12
54 0.11
55 0.09
56 0.09
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.1
66 0.1
67 0.11
68 0.16
69 0.2
70 0.23
71 0.26
72 0.29
73 0.34
74 0.35
75 0.35
76 0.29
77 0.26
78 0.22
79 0.2
80 0.18
81 0.13
82 0.14
83 0.14
84 0.17
85 0.22
86 0.27
87 0.3
88 0.33
89 0.36
90 0.44
91 0.49
92 0.52
93 0.55
94 0.5
95 0.5
96 0.5
97 0.52
98 0.47
99 0.43
100 0.42
101 0.37
102 0.39
103 0.36
104 0.34
105 0.33
106 0.32
107 0.34
108 0.37
109 0.4
110 0.42
111 0.49
112 0.5
113 0.47
114 0.5
115 0.52
116 0.49
117 0.48
118 0.45
119 0.47
120 0.49
121 0.5
122 0.49
123 0.48
124 0.48
125 0.47
126 0.47
127 0.41
128 0.37
129 0.39
130 0.34
131 0.31
132 0.31
133 0.28
134 0.25
135 0.21
136 0.19
137 0.13
138 0.14
139 0.12
140 0.08
141 0.12
142 0.15
143 0.23
144 0.31
145 0.38
146 0.44
147 0.48
148 0.52
149 0.55
150 0.54
151 0.47
152 0.45
153 0.4
154 0.37
155 0.36
156 0.32
157 0.25
158 0.23
159 0.22
160 0.17
161 0.18
162 0.16
163 0.19
164 0.21
165 0.26
166 0.29
167 0.3
168 0.33
169 0.36
170 0.42
171 0.47
172 0.56
173 0.61
174 0.69
175 0.79
176 0.87
177 0.92
178 0.94
179 0.94
180 0.95
181 0.93
182 0.88
183 0.88
184 0.84
185 0.79
186 0.75
187 0.68
188 0.59
189 0.49
190 0.44
191 0.33
192 0.26
193 0.2
194 0.13
195 0.09