Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BRX9

Protein Details
Accession G8BRX9   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-67KSIHHDKSKKSKNNKPITRYBasic
NLS Segment(s)
PositionSequence
34-61KRSKKEILKRAVSLKSIHHDKSKKSKNN
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
KEGG tpf:TPHA_0D04205  -  
Amino Acid Sequences MFSKMKALFHKPREINNQQGKPTSYVIDEDPLPKRSKKEILKRAVSLKSIHHDKSKKSKNNKPITRYDIFNSHYGEQFHSKVSVIINREETANFFYYTDASSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.71
3 0.71
4 0.71
5 0.64
6 0.65
7 0.59
8 0.52
9 0.47
10 0.38
11 0.29
12 0.24
13 0.21
14 0.19
15 0.18
16 0.19
17 0.21
18 0.23
19 0.25
20 0.25
21 0.28
22 0.31
23 0.39
24 0.44
25 0.51
26 0.57
27 0.63
28 0.66
29 0.66
30 0.67
31 0.6
32 0.53
33 0.44
34 0.37
35 0.34
36 0.34
37 0.32
38 0.33
39 0.33
40 0.36
41 0.45
42 0.53
43 0.55
44 0.6
45 0.67
46 0.7
47 0.78
48 0.81
49 0.76
50 0.75
51 0.73
52 0.67
53 0.61
54 0.53
55 0.49
56 0.43
57 0.41
58 0.36
59 0.3
60 0.3
61 0.28
62 0.29
63 0.26
64 0.25
65 0.22
66 0.2
67 0.19
68 0.17
69 0.19
70 0.21
71 0.2
72 0.23
73 0.24
74 0.24
75 0.25
76 0.24
77 0.23
78 0.22
79 0.22
80 0.19
81 0.16
82 0.16
83 0.16