Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JW45

Protein Details
Accession A0A2H3JW45    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-36GKVLLCCKSKRRRWFLPTGRKDVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 10.833, cyto_nucl 7.333, cyto 7, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015797  NUDIX_hydrolase-like_dom_sf  
IPR020084  NUDIX_hydrolase_CS  
IPR000086  NUDIX_hydrolase_dom  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF00293  NUDIX  
PROSITE View protein in PROSITE  
PS51462  NUDIX  
PS00893  NUDIX_BOX  
CDD cd02883  Nudix_Hydrolase  
Amino Acid Sequences MLGAGLVIIQPSSGKVLLCCKSKRRRWFLPTGRKDVGESIEQAALREVYEEIRKSDTGLPTEQDYVSHLLDIDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.18
4 0.23
5 0.3
6 0.35
7 0.42
8 0.51
9 0.6
10 0.69
11 0.71
12 0.75
13 0.75
14 0.81
15 0.82
16 0.83
17 0.81
18 0.78
19 0.71
20 0.61
21 0.54
22 0.45
23 0.36
24 0.26
25 0.2
26 0.14
27 0.14
28 0.13
29 0.13
30 0.11
31 0.09
32 0.08
33 0.08
34 0.07
35 0.07
36 0.11
37 0.12
38 0.13
39 0.16
40 0.16
41 0.18
42 0.23
43 0.24
44 0.24
45 0.25
46 0.25
47 0.25
48 0.27
49 0.25
50 0.2
51 0.19
52 0.19
53 0.18
54 0.16
55 0.13