Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JJS9

Protein Details
Accession A0A2H3JJS9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-29RLFCKGRVLGHKRAKRNTRPNTSLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 11, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLFCKGRVLGHKRAKRNTRPNTSLLQIEGVATKEDAQFYLGKRVAYVYKAKRVIQGTKLRVIWGRVTRPHGNSGVVKSKFRSNLPPHAFGASVRVMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.71
3 0.73
4 0.78
5 0.81
6 0.81
7 0.85
8 0.85
9 0.85
10 0.81
11 0.76
12 0.71
13 0.63
14 0.54
15 0.44
16 0.34
17 0.24
18 0.2
19 0.17
20 0.13
21 0.11
22 0.09
23 0.09
24 0.09
25 0.09
26 0.08
27 0.09
28 0.1
29 0.11
30 0.18
31 0.18
32 0.18
33 0.17
34 0.19
35 0.18
36 0.19
37 0.26
38 0.22
39 0.28
40 0.31
41 0.32
42 0.35
43 0.37
44 0.39
45 0.39
46 0.44
47 0.4
48 0.42
49 0.42
50 0.38
51 0.37
52 0.34
53 0.33
54 0.3
55 0.32
56 0.31
57 0.38
58 0.41
59 0.42
60 0.44
61 0.39
62 0.37
63 0.34
64 0.36
65 0.38
66 0.36
67 0.35
68 0.34
69 0.38
70 0.39
71 0.4
72 0.45
73 0.42
74 0.5
75 0.55
76 0.57
77 0.52
78 0.49
79 0.47
80 0.37
81 0.35
82 0.25
83 0.2
84 0.16
85 0.15
86 0.13