Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3IWE4

Protein Details
Accession A0A2H3IWE4   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-65SDEEAKKLWRRKAPRDKQELPGBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.5, cyto 11, mito 8, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006993  Glut_rich_SH3-bd  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF04908  SH3BGR  
Amino Acid Sequences MAPPPIQLFLTTITSQTALRQRQEYILRVLQVKKVPFTSYDLASDEEAKKLWRRKAPRDKQELPGILIGGEFSGTFGEFEEAVEFNELDQFLRLKENWKPFEDDKPTLPAQPVGVPGAYSPAQMHPHHQPSPSPSPSPMRGKPVSAKRDPKAIDAGEELGDSKLQGVDVTEDDLLALVEELGLGGDEANDLVKGLTGDSAPAKTDDAPSKKDESEPQAKAGASEAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.23
4 0.28
5 0.29
6 0.33
7 0.35
8 0.35
9 0.42
10 0.47
11 0.44
12 0.43
13 0.41
14 0.4
15 0.42
16 0.43
17 0.41
18 0.41
19 0.4
20 0.36
21 0.35
22 0.33
23 0.3
24 0.34
25 0.32
26 0.28
27 0.28
28 0.26
29 0.25
30 0.24
31 0.27
32 0.22
33 0.19
34 0.18
35 0.18
36 0.24
37 0.3
38 0.37
39 0.41
40 0.49
41 0.59
42 0.7
43 0.78
44 0.81
45 0.84
46 0.82
47 0.79
48 0.79
49 0.7
50 0.6
51 0.5
52 0.4
53 0.3
54 0.24
55 0.18
56 0.09
57 0.07
58 0.04
59 0.03
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.06
68 0.06
69 0.07
70 0.07
71 0.07
72 0.06
73 0.07
74 0.07
75 0.06
76 0.07
77 0.07
78 0.07
79 0.09
80 0.09
81 0.12
82 0.18
83 0.26
84 0.29
85 0.3
86 0.35
87 0.34
88 0.42
89 0.45
90 0.41
91 0.34
92 0.35
93 0.34
94 0.3
95 0.28
96 0.21
97 0.15
98 0.14
99 0.14
100 0.1
101 0.09
102 0.08
103 0.07
104 0.09
105 0.09
106 0.08
107 0.08
108 0.1
109 0.14
110 0.14
111 0.18
112 0.21
113 0.27
114 0.29
115 0.29
116 0.28
117 0.31
118 0.38
119 0.38
120 0.33
121 0.3
122 0.32
123 0.38
124 0.43
125 0.39
126 0.39
127 0.37
128 0.39
129 0.44
130 0.49
131 0.51
132 0.52
133 0.57
134 0.51
135 0.58
136 0.56
137 0.51
138 0.47
139 0.4
140 0.33
141 0.26
142 0.26
143 0.18
144 0.17
145 0.15
146 0.1
147 0.09
148 0.07
149 0.07
150 0.06
151 0.05
152 0.05
153 0.05
154 0.07
155 0.07
156 0.09
157 0.08
158 0.08
159 0.08
160 0.08
161 0.07
162 0.05
163 0.05
164 0.03
165 0.03
166 0.03
167 0.03
168 0.02
169 0.03
170 0.02
171 0.02
172 0.03
173 0.03
174 0.03
175 0.04
176 0.04
177 0.04
178 0.04
179 0.05
180 0.05
181 0.05
182 0.06
183 0.06
184 0.08
185 0.1
186 0.11
187 0.11
188 0.12
189 0.14
190 0.14
191 0.2
192 0.27
193 0.3
194 0.33
195 0.37
196 0.4
197 0.41
198 0.44
199 0.45
200 0.45
201 0.49
202 0.48
203 0.47
204 0.46
205 0.44
206 0.4