Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JE68

Protein Details
Accession A0A2H3JE68    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
62-82APANRARRSLQRRRGRRPAPAHydrophilic
NLS Segment(s)
PositionSequence
56-95VRRRARAPANRARRSLQRRRGRRPAPAGLRHASRPTPLPG
118-125RAPRRARP
Subcellular Location(s) nucl 9, extr 7, mito_nucl 7, mito 5
Family & Domain DBs
Amino Acid Sequences MRQISHLASSSRELDIVPPAFVAPAALATTPTPRPMSLILRRLLATDARHAAVPSVRRRARAPANRARRSLQRRRGRRPAPAGLRHASRPTPLPGDSRRHAPLERVSAACALHRWHARAPRRARPRQGPSVVNADQASPDPRSTDFVLLRRGGARTSFEASPPCVCVLEPASQSRRLLCWSRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.23
3 0.22
4 0.18
5 0.16
6 0.15
7 0.15
8 0.15
9 0.13
10 0.06
11 0.06
12 0.06
13 0.06
14 0.07
15 0.08
16 0.12
17 0.13
18 0.16
19 0.16
20 0.16
21 0.18
22 0.21
23 0.29
24 0.33
25 0.38
26 0.37
27 0.37
28 0.37
29 0.36
30 0.34
31 0.29
32 0.23
33 0.21
34 0.22
35 0.2
36 0.2
37 0.19
38 0.19
39 0.19
40 0.24
41 0.25
42 0.33
43 0.34
44 0.36
45 0.38
46 0.44
47 0.51
48 0.54
49 0.57
50 0.57
51 0.66
52 0.69
53 0.71
54 0.66
55 0.66
56 0.66
57 0.68
58 0.68
59 0.67
60 0.71
61 0.78
62 0.85
63 0.8
64 0.79
65 0.76
66 0.74
67 0.73
68 0.69
69 0.65
70 0.57
71 0.54
72 0.47
73 0.42
74 0.33
75 0.26
76 0.22
77 0.2
78 0.19
79 0.18
80 0.21
81 0.24
82 0.29
83 0.29
84 0.32
85 0.32
86 0.32
87 0.31
88 0.3
89 0.29
90 0.29
91 0.3
92 0.25
93 0.24
94 0.23
95 0.22
96 0.19
97 0.16
98 0.12
99 0.15
100 0.16
101 0.18
102 0.21
103 0.29
104 0.37
105 0.45
106 0.51
107 0.56
108 0.64
109 0.7
110 0.74
111 0.76
112 0.76
113 0.77
114 0.76
115 0.68
116 0.6
117 0.6
118 0.53
119 0.45
120 0.37
121 0.28
122 0.22
123 0.22
124 0.21
125 0.15
126 0.15
127 0.13
128 0.14
129 0.18
130 0.19
131 0.23
132 0.25
133 0.27
134 0.32
135 0.31
136 0.32
137 0.3
138 0.29
139 0.24
140 0.23
141 0.23
142 0.21
143 0.24
144 0.24
145 0.24
146 0.26
147 0.27
148 0.27
149 0.25
150 0.22
151 0.18
152 0.17
153 0.19
154 0.19
155 0.23
156 0.24
157 0.3
158 0.33
159 0.37
160 0.38
161 0.36
162 0.36
163 0.36