Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3IXL3

Protein Details
Accession A0A2H3IXL3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
110-130PKHACRAQGARRKGARRKRLRBasic
NLS Segment(s)
PositionSequence
116-130AQGARRKGARRKRLR
Subcellular Location(s) mito 16, cyto 5.5, cyto_nucl 5.5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MPGLRGHFLRGSVTTKVAETDTYWALPASHAISVKTSAIGGRRRAPGAADSEQAQHDRIRVQRGLVVPFPPVPRWPSVCLPGQTPLTGSADPHPRDRELSRKRHVADDVPKHACRAQGARRKGARRKRLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.22
4 0.2
5 0.17
6 0.15
7 0.16
8 0.16
9 0.15
10 0.15
11 0.14
12 0.13
13 0.12
14 0.13
15 0.1
16 0.11
17 0.12
18 0.12
19 0.13
20 0.14
21 0.14
22 0.12
23 0.11
24 0.1
25 0.15
26 0.2
27 0.23
28 0.27
29 0.29
30 0.3
31 0.3
32 0.3
33 0.26
34 0.27
35 0.25
36 0.2
37 0.19
38 0.19
39 0.2
40 0.2
41 0.18
42 0.13
43 0.12
44 0.14
45 0.16
46 0.19
47 0.18
48 0.18
49 0.2
50 0.21
51 0.23
52 0.21
53 0.19
54 0.15
55 0.17
56 0.18
57 0.15
58 0.15
59 0.15
60 0.16
61 0.19
62 0.22
63 0.22
64 0.24
65 0.27
66 0.27
67 0.26
68 0.27
69 0.25
70 0.21
71 0.2
72 0.18
73 0.17
74 0.16
75 0.15
76 0.16
77 0.24
78 0.25
79 0.29
80 0.3
81 0.29
82 0.33
83 0.36
84 0.41
85 0.43
86 0.51
87 0.53
88 0.58
89 0.59
90 0.61
91 0.6
92 0.58
93 0.59
94 0.59
95 0.6
96 0.59
97 0.58
98 0.54
99 0.53
100 0.46
101 0.41
102 0.41
103 0.42
104 0.46
105 0.52
106 0.59
107 0.66
108 0.74
109 0.79
110 0.81