Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3JYN4

Protein Details
Accession A0A2H3JYN4    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
181-206YGERMERASRSPRRKKKSITTYTPRIHydrophilic
NLS Segment(s)
PositionSequence
4-25KRARKAAAAIRRPRHPAVKGLK
188-197ASRSPRRKKK
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MGSKRARKAAAAIRRPRHPAVKGLKIEIPKQREFTAEQLTELKNDMFYGKLTPLESEGSSSCMTPEKGEDTQIANETYRASAAGPHRNDSDERNNQWPQNLKGRNDYFGSREEKLMERGASPALSDSTCVSYCICPGIPCFVRRQYASSTGEDIDIDERVDSPLLRRRLSDLSELTGESLYGERMERASRSPRRKKKSITTYTPRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.75
3 0.72
4 0.71
5 0.63
6 0.63
7 0.62
8 0.64
9 0.61
10 0.59
11 0.57
12 0.53
13 0.57
14 0.55
15 0.53
16 0.47
17 0.47
18 0.44
19 0.42
20 0.41
21 0.4
22 0.41
23 0.34
24 0.32
25 0.33
26 0.32
27 0.3
28 0.28
29 0.23
30 0.14
31 0.14
32 0.13
33 0.1
34 0.1
35 0.11
36 0.11
37 0.13
38 0.13
39 0.13
40 0.14
41 0.15
42 0.14
43 0.14
44 0.13
45 0.14
46 0.14
47 0.14
48 0.13
49 0.13
50 0.14
51 0.12
52 0.14
53 0.15
54 0.15
55 0.17
56 0.18
57 0.17
58 0.19
59 0.2
60 0.19
61 0.14
62 0.14
63 0.14
64 0.12
65 0.1
66 0.08
67 0.06
68 0.1
69 0.15
70 0.22
71 0.23
72 0.24
73 0.25
74 0.27
75 0.28
76 0.28
77 0.32
78 0.31
79 0.33
80 0.37
81 0.39
82 0.38
83 0.4
84 0.4
85 0.34
86 0.37
87 0.39
88 0.34
89 0.4
90 0.4
91 0.39
92 0.36
93 0.34
94 0.26
95 0.26
96 0.29
97 0.21
98 0.21
99 0.21
100 0.2
101 0.21
102 0.21
103 0.17
104 0.14
105 0.14
106 0.14
107 0.12
108 0.1
109 0.09
110 0.08
111 0.07
112 0.07
113 0.08
114 0.1
115 0.1
116 0.1
117 0.11
118 0.1
119 0.1
120 0.12
121 0.11
122 0.09
123 0.1
124 0.16
125 0.18
126 0.19
127 0.23
128 0.26
129 0.29
130 0.3
131 0.32
132 0.29
133 0.34
134 0.36
135 0.33
136 0.31
137 0.28
138 0.27
139 0.24
140 0.21
141 0.14
142 0.11
143 0.1
144 0.07
145 0.07
146 0.08
147 0.08
148 0.08
149 0.11
150 0.19
151 0.23
152 0.24
153 0.25
154 0.28
155 0.33
156 0.36
157 0.38
158 0.32
159 0.31
160 0.31
161 0.31
162 0.27
163 0.22
164 0.19
165 0.13
166 0.11
167 0.08
168 0.08
169 0.09
170 0.09
171 0.11
172 0.13
173 0.14
174 0.19
175 0.29
176 0.38
177 0.49
178 0.59
179 0.68
180 0.75
181 0.83
182 0.87
183 0.88
184 0.9
185 0.89
186 0.89