Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BUW7

Protein Details
Accession G8BUW7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
98-122AAKMHAKKVDRLRRREKRNKALKERBasic
NLS Segment(s)
PositionSequence
53-122KLEDKQFKDRLKALKDEKEEARKTKIQALKERREKKEEKERYERLAAKMHAKKVDRLRRREKRNKALKER
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG tpf:TPHA_0F00620  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSEVQNEIVDASKTRGTRVSGKTWKEERTPFRVTSSVIKNKKFTSWEAKQQKKLEDKQFKDRLKALKDEKEEARKTKIQALKERREKKEEKERYERLAAKMHAKKVDRLRRREKRNKALKER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.25
4 0.33
5 0.37
6 0.44
7 0.48
8 0.52
9 0.59
10 0.61
11 0.62
12 0.59
13 0.63
14 0.59
15 0.58
16 0.59
17 0.51
18 0.49
19 0.46
20 0.41
21 0.4
22 0.43
23 0.45
24 0.46
25 0.48
26 0.48
27 0.48
28 0.5
29 0.45
30 0.4
31 0.4
32 0.4
33 0.47
34 0.54
35 0.59
36 0.62
37 0.64
38 0.66
39 0.64
40 0.67
41 0.67
42 0.66
43 0.64
44 0.66
45 0.72
46 0.67
47 0.62
48 0.58
49 0.54
50 0.47
51 0.5
52 0.45
53 0.43
54 0.44
55 0.45
56 0.46
57 0.48
58 0.48
59 0.44
60 0.45
61 0.42
62 0.41
63 0.44
64 0.44
65 0.42
66 0.48
67 0.55
68 0.59
69 0.66
70 0.74
71 0.71
72 0.75
73 0.73
74 0.72
75 0.74
76 0.73
77 0.72
78 0.72
79 0.72
80 0.69
81 0.73
82 0.69
83 0.61
84 0.59
85 0.53
86 0.53
87 0.55
88 0.54
89 0.53
90 0.51
91 0.55
92 0.58
93 0.66
94 0.66
95 0.69
96 0.75
97 0.78
98 0.87
99 0.9
100 0.91
101 0.91
102 0.92