Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JP24

Protein Details
Accession A0A2H3JP24    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
112-147EAQKAMRQKDGRRKLKGRRVVKRRREPTYRNPPIDPBasic
NLS Segment(s)
PositionSequence
117-137MRQKDGRRKLKGRRVVKRRRE
Subcellular Location(s) cyto 18, nucl 4, mito 3
Family & Domain DBs
Amino Acid Sequences MSSNIEQAIHNALTDALELTVPNVLVAYLRILGYALPSGASTPIPHEALVAFEHALDKEPAGALGRRMYTAEVARLRREYWKERIGVPAGGRCTCPACGKTVAYEKEEAEEEAQKAMRQKDGRRKLKGRRVVKRRREPTYRNPPIDPYGPSTSALAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.06
4 0.06
5 0.06
6 0.06
7 0.08
8 0.07
9 0.06
10 0.06
11 0.05
12 0.05
13 0.06
14 0.07
15 0.07
16 0.07
17 0.07
18 0.07
19 0.07
20 0.08
21 0.08
22 0.06
23 0.05
24 0.06
25 0.06
26 0.07
27 0.07
28 0.07
29 0.09
30 0.12
31 0.12
32 0.12
33 0.12
34 0.11
35 0.12
36 0.12
37 0.11
38 0.07
39 0.07
40 0.08
41 0.07
42 0.09
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.07
49 0.08
50 0.08
51 0.1
52 0.1
53 0.1
54 0.11
55 0.11
56 0.12
57 0.12
58 0.15
59 0.18
60 0.19
61 0.2
62 0.21
63 0.21
64 0.24
65 0.29
66 0.29
67 0.31
68 0.34
69 0.34
70 0.34
71 0.37
72 0.33
73 0.31
74 0.26
75 0.23
76 0.21
77 0.2
78 0.19
79 0.16
80 0.16
81 0.15
82 0.18
83 0.15
84 0.16
85 0.18
86 0.18
87 0.22
88 0.28
89 0.28
90 0.27
91 0.29
92 0.25
93 0.25
94 0.25
95 0.22
96 0.16
97 0.16
98 0.15
99 0.15
100 0.15
101 0.15
102 0.19
103 0.2
104 0.25
105 0.28
106 0.36
107 0.45
108 0.56
109 0.63
110 0.69
111 0.77
112 0.8
113 0.85
114 0.86
115 0.86
116 0.86
117 0.88
118 0.89
119 0.91
120 0.91
121 0.9
122 0.9
123 0.89
124 0.87
125 0.87
126 0.87
127 0.87
128 0.81
129 0.74
130 0.7
131 0.66
132 0.61
133 0.53
134 0.48
135 0.44
136 0.4
137 0.38