Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8C200

Protein Details
Accession G8C200    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVTSKQQYNKKKFTREYKVKEIQKNLTHydrophilic
56-123NEKYDYKKRKEEREQENRRRALERKAMKQEKKWKEKQRTLQRQQTQEERTKTIQLKLKDRERRRERLTBasic
NLS Segment(s)
PositionSequence
24-34KNLTKKARLKK
62-93KKRKEEREQENRRRALERKAMKQEKKWKEKQR
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
KEGG tpf:TPHA_0P00200  -  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MVTSKQQYNKKKFTREYKVKEIQKNLTKKARLKKEYLKALKEEGYAVPEKAPSEGNEKYDYKKRKEEREQENRRRALERKAMKQEKKWKEKQRTLQRQQTQEERTKTIQLKLKDRERRRERLTQMTRSGQPKMGPKIEDLLNKIKTDDTYTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.86
4 0.86
5 0.87
6 0.86
7 0.85
8 0.81
9 0.8
10 0.78
11 0.77
12 0.75
13 0.74
14 0.72
15 0.72
16 0.75
17 0.76
18 0.73
19 0.73
20 0.75
21 0.75
22 0.78
23 0.78
24 0.72
25 0.64
26 0.62
27 0.56
28 0.47
29 0.39
30 0.29
31 0.25
32 0.22
33 0.19
34 0.16
35 0.15
36 0.14
37 0.13
38 0.14
39 0.12
40 0.16
41 0.18
42 0.19
43 0.23
44 0.24
45 0.27
46 0.34
47 0.4
48 0.39
49 0.47
50 0.51
51 0.57
52 0.66
53 0.71
54 0.74
55 0.78
56 0.84
57 0.85
58 0.87
59 0.79
60 0.71
61 0.65
62 0.57
63 0.53
64 0.51
65 0.47
66 0.47
67 0.55
68 0.61
69 0.61
70 0.67
71 0.7
72 0.71
73 0.74
74 0.76
75 0.76
76 0.78
77 0.83
78 0.86
79 0.86
80 0.88
81 0.87
82 0.87
83 0.84
84 0.8
85 0.76
86 0.73
87 0.68
88 0.65
89 0.59
90 0.54
91 0.48
92 0.49
93 0.47
94 0.45
95 0.45
96 0.43
97 0.49
98 0.53
99 0.61
100 0.64
101 0.69
102 0.74
103 0.76
104 0.8
105 0.78
106 0.79
107 0.76
108 0.77
109 0.78
110 0.75
111 0.73
112 0.7
113 0.7
114 0.64
115 0.6
116 0.53
117 0.49
118 0.49
119 0.5
120 0.49
121 0.43
122 0.41
123 0.43
124 0.45
125 0.45
126 0.42
127 0.43
128 0.41
129 0.4
130 0.4
131 0.37
132 0.33