Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8C110

Protein Details
Accession G8C110   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-26VLIFNKKCQPRLRKFYTPVELPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8, cyto_nucl 6.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016635  AP_complex_ssu  
IPR022775  AP_mu_sigma_su  
IPR000804  Clathrin_sm-chain_CS  
IPR011012  Longin-like_dom_sf  
Gene Ontology GO:0030117  C:membrane coat  
GO:0006886  P:intracellular protein transport  
GO:0016192  P:vesicle-mediated transport  
KEGG tpf:TPHA_0N00570  -  
Pfam View protein in Pfam  
PF01217  Clat_adaptor_s  
PROSITE View protein in PROSITE  
PS00989  CLAT_ADAPTOR_S  
Amino Acid Sequences MIHGVLIFNKKCQPRLRKFYTPVELPKQKLLLEQVYSYISQRNTELQCSFMVAPSSVLSDSRGSVTDDDNIQIIYKNYATLYFAFIVDEQESELVILDLIQTFVEALDRCFTEVSELDLIFNWQTLESVLEEIIQGGMVIETSVAKIVNCVDDLNNASEESESGAGMFGGTAIGNAFQALTNGKFSQWASSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.69
3 0.74
4 0.77
5 0.8
6 0.83
7 0.81
8 0.77
9 0.74
10 0.74
11 0.72
12 0.65
13 0.63
14 0.56
15 0.48
16 0.44
17 0.41
18 0.35
19 0.31
20 0.28
21 0.25
22 0.24
23 0.24
24 0.22
25 0.22
26 0.18
27 0.17
28 0.18
29 0.23
30 0.23
31 0.26
32 0.26
33 0.23
34 0.22
35 0.24
36 0.22
37 0.17
38 0.16
39 0.12
40 0.13
41 0.11
42 0.12
43 0.1
44 0.1
45 0.1
46 0.09
47 0.1
48 0.1
49 0.1
50 0.1
51 0.11
52 0.12
53 0.13
54 0.12
55 0.12
56 0.11
57 0.1
58 0.09
59 0.09
60 0.09
61 0.08
62 0.08
63 0.08
64 0.08
65 0.08
66 0.09
67 0.09
68 0.1
69 0.09
70 0.09
71 0.09
72 0.09
73 0.1
74 0.09
75 0.08
76 0.06
77 0.05
78 0.05
79 0.05
80 0.04
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.05
92 0.05
93 0.05
94 0.06
95 0.07
96 0.07
97 0.07
98 0.07
99 0.08
100 0.08
101 0.1
102 0.11
103 0.11
104 0.1
105 0.1
106 0.11
107 0.09
108 0.09
109 0.06
110 0.05
111 0.05
112 0.05
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.05
121 0.04
122 0.04
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.04
131 0.04
132 0.04
133 0.05
134 0.06
135 0.08
136 0.08
137 0.09
138 0.09
139 0.12
140 0.14
141 0.15
142 0.15
143 0.14
144 0.14
145 0.13
146 0.12
147 0.12
148 0.1
149 0.08
150 0.07
151 0.07
152 0.07
153 0.06
154 0.06
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.05
163 0.05
164 0.05
165 0.06
166 0.09
167 0.1
168 0.14
169 0.15
170 0.15
171 0.18
172 0.19