FuNGI

A0A2H3JPM9

Protein Details

Accession

A0A2H3JPM9

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
499-528	RGRWASKAKYFSVRRRRKRDWNETLRLYDQ	Hydrophilic

NLS Segment(s)

Position	Sequence
493-517	REKGRVRGRWASKAKYFSVRRRRKR

Subcellular Location(s)

plas 18, mito 4, vacu 2, mito_nucl 2

Family & Domain DBs

InterPro	View protein in InterPro IPR002123 Plipid/glycerol_acylTrfase
Gene Ontology	GO:0016020 C:membrane GO:0016746 F:acyltransferase activity
Pfam	View protein in Pfam PF01553 Acyltransferase
CDD	cd07992 LPLAT_AAK14816-like

Amino Acid Sequences

MPSGSPTPWSYFFIRLLFKFVLKIFYGTIVVENAHLIPPRGQPCIVCANHSNSLTDALLLVTAIPSKKRNLLRLTAKSTQFGKKTLTSWLIESAGTVPIKRRKDFPDGQADNTTVMLKLIEALECGDAVCLFPEGMSRYHPTIAPLKTGVARLVSDVLSRNRHNPKFEISVLTCSITYMHRQHFRSDVLVTFHEPIRFTPENNPELLDPVDYDKIRALTARMHQQISSGTLDAPSWRLVRDAKLAARMYAPLGTTMSLGDYVRVVRTFLEAFKLAERPIPESGSEGETVKKEGALEDFKIRQLSNDLRDYQNQLARWGIKDDRIRRPLSRPIILYRIFVRFSWSLVLLSISIPGLLLWFPVFVTTFIAVSRFKSTGPIWDTWDEIAQYKLIYGLVSGACVWGGSVLLTLPVAPLTAVLVPAAMWMSLRWLEDAVSAFRAFLALARMLLRIGQRRLHEMRAVRARLHARVMELAVGTLGLPPDPEVHFAESGGREKGRVRGRWASKAKYFSVRRRRKRDWNETLRLYDQVDYPEDEY

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.4
2	0.35
3	0.39
4	0.36
5	0.34
6	0.34
7	0.31
8	0.31
9	0.26
10	0.27
11	0.22
12	0.22
13	0.22
14	0.18
15	0.18
16	0.15
17	0.14
18	0.13
19	0.13
20	0.11
21	0.13
22	0.14
23	0.14
24	0.17
25	0.24
26	0.27
27	0.3
28	0.3
29	0.27
30	0.3
31	0.39
32	0.36
33	0.33
34	0.33
35	0.37
36	0.42
37	0.42
38	0.39
39	0.3
40	0.32
41	0.28
42	0.23
43	0.17
44	0.11
45	0.1
46	0.09
47	0.08
48	0.05
49	0.08
50	0.1
51	0.13
52	0.16
53	0.19
54	0.28
55	0.34
56	0.41
57	0.45
58	0.53
59	0.6
60	0.66
61	0.71
62	0.7
63	0.66
64	0.63
65	0.62
66	0.6
67	0.53
68	0.47
69	0.44
70	0.4
71	0.39
72	0.41
73	0.41
74	0.34
75	0.33
76	0.33
77	0.29
78	0.25
79	0.24
80	0.19
81	0.18
82	0.17
83	0.17
84	0.2
85	0.27
86	0.34
87	0.35
88	0.41
89	0.42
90	0.51
91	0.58
92	0.58
93	0.61
94	0.58
95	0.6
96	0.56
97	0.51
98	0.42
99	0.35
100	0.28
101	0.17
102	0.14
103	0.1
104	0.07
105	0.07
106	0.08
107	0.07
108	0.07
109	0.07
110	0.08
111	0.07
112	0.08
113	0.06
114	0.05
115	0.05
116	0.06
117	0.05
118	0.05
119	0.05
120	0.07
121	0.09
122	0.1
123	0.13
124	0.15
125	0.17
126	0.19
127	0.19
128	0.2
129	0.26
130	0.26
131	0.26
132	0.23
133	0.23
134	0.24
135	0.24
136	0.22
137	0.16
138	0.15
139	0.13
140	0.14
141	0.13
142	0.12
143	0.15
144	0.19
145	0.23
146	0.24
147	0.32
148	0.4
149	0.43
150	0.46
151	0.45
152	0.46
153	0.46
154	0.46
155	0.44
156	0.35
157	0.35
158	0.32
159	0.31
160	0.25
161	0.19
162	0.19
163	0.14
164	0.17
165	0.19
166	0.25
167	0.31
168	0.33
169	0.35
170	0.37
171	0.38
172	0.35
173	0.31
174	0.26
175	0.22
176	0.22
177	0.21
178	0.2
179	0.2
180	0.19
181	0.18
182	0.16
183	0.22
184	0.21
185	0.21
186	0.27
187	0.32
188	0.32
189	0.32
190	0.33
191	0.24
192	0.25
193	0.24
194	0.16
195	0.1
196	0.11
197	0.14
198	0.13
199	0.13
200	0.13
201	0.13
202	0.13
203	0.13
204	0.12
205	0.13
206	0.17
207	0.24
208	0.26
209	0.26
210	0.26
211	0.26
212	0.26
213	0.24
214	0.21
215	0.13
216	0.11
217	0.1
218	0.1
219	0.1
220	0.1
221	0.1
222	0.09
223	0.09
224	0.11
225	0.11
226	0.13
227	0.17
228	0.19
229	0.18
230	0.24
231	0.24
232	0.22
233	0.22
234	0.2
235	0.17
236	0.15
237	0.13
238	0.08
239	0.08
240	0.08
241	0.07
242	0.07
243	0.06
244	0.06
245	0.06
246	0.05
247	0.06
248	0.06
249	0.06
250	0.06
251	0.06
252	0.06
253	0.07
254	0.08
255	0.08
256	0.1
257	0.09
258	0.1
259	0.11
260	0.12
261	0.11
262	0.12
263	0.12
264	0.13
265	0.14
266	0.14
267	0.13
268	0.13
269	0.14
270	0.13
271	0.13
272	0.11
273	0.11
274	0.11
275	0.12
276	0.1
277	0.09
278	0.08
279	0.08
280	0.1
281	0.11
282	0.12
283	0.15
284	0.16
285	0.17
286	0.18
287	0.17
288	0.15
289	0.18
290	0.21
291	0.22
292	0.25
293	0.27
294	0.27
295	0.29
296	0.32
297	0.31
298	0.3
299	0.25
300	0.22
301	0.22
302	0.22
303	0.21
304	0.21
305	0.18
306	0.21
307	0.28
308	0.34
309	0.41
310	0.46
311	0.48
312	0.47
313	0.52
314	0.54
315	0.53
316	0.5
317	0.43
318	0.41
319	0.45
320	0.43
321	0.39
322	0.33
323	0.3
324	0.27
325	0.24
326	0.26
327	0.19
328	0.19
329	0.19
330	0.17
331	0.14
332	0.13
333	0.13
334	0.09
335	0.08
336	0.08
337	0.06
338	0.05
339	0.05
340	0.04
341	0.05
342	0.04
343	0.04
344	0.04
345	0.04
346	0.04
347	0.05
348	0.05
349	0.05
350	0.07
351	0.07
352	0.08
353	0.08
354	0.1
355	0.1
356	0.11
357	0.14
358	0.13
359	0.12
360	0.16
361	0.17
362	0.22
363	0.26
364	0.26
365	0.27
366	0.27
367	0.28
368	0.25
369	0.26
370	0.19
371	0.16
372	0.15
373	0.11
374	0.1
375	0.09
376	0.09
377	0.07
378	0.06
379	0.06
380	0.08
381	0.07
382	0.08
383	0.08
384	0.07
385	0.07
386	0.06
387	0.06
388	0.04
389	0.04
390	0.03
391	0.03
392	0.03
393	0.04
394	0.04
395	0.04
396	0.04
397	0.04
398	0.04
399	0.04
400	0.04
401	0.05
402	0.05
403	0.05
404	0.05
405	0.05
406	0.05
407	0.05
408	0.06
409	0.04
410	0.04
411	0.04
412	0.07
413	0.09
414	0.09
415	0.1
416	0.1
417	0.1
418	0.12
419	0.14
420	0.13
421	0.14
422	0.13
423	0.12
424	0.12
425	0.12
426	0.1
427	0.09
428	0.11
429	0.09
430	0.1
431	0.11
432	0.11
433	0.11
434	0.14
435	0.18
436	0.22
437	0.25
438	0.29
439	0.31
440	0.39
441	0.43
442	0.44
443	0.45
444	0.42
445	0.47
446	0.52
447	0.52
448	0.45
449	0.49
450	0.49
451	0.46
452	0.48
453	0.4
454	0.33
455	0.33
456	0.32
457	0.27
458	0.22
459	0.19
460	0.13
461	0.12
462	0.1
463	0.08
464	0.07
465	0.06
466	0.06
467	0.06
468	0.1
469	0.11
470	0.14
471	0.15
472	0.18
473	0.19
474	0.19
475	0.23
476	0.23
477	0.25
478	0.26
479	0.24
480	0.23
481	0.25
482	0.33
483	0.37
484	0.39
485	0.44
486	0.5
487	0.57
488	0.66
489	0.72
490	0.72
491	0.7
492	0.71
493	0.69
494	0.69
495	0.71
496	0.71
497	0.74
498	0.77
499	0.8
500	0.85
501	0.9
502	0.91
503	0.93
504	0.93
505	0.93
506	0.93
507	0.92
508	0.88
509	0.84
510	0.75
511	0.67
512	0.57
513	0.48
514	0.4
515	0.34
516	0.3

A0A2H3JPM9

3D AlphaFold-predicted Structure Viewer