Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3J863

Protein Details
Accession A0A2H3J863    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
95-122GPGGKAEKARLRRENKQRIREQNFMKTQHydrophilic
NLS Segment(s)
PositionSequence
95-112GPGGKAEKARLRRENKQR
Subcellular Location(s) mito 19, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSLLRVLRRPPGLTAWYPARRCYASSTKPVEAAAPTTQKADEPAAVVSRSSCPEGTILAGVQHLKGQPPIAAQPDDAYPAWLWTLLEKKKIPDDGPGGKAEKARLRRENKQRIREQNFMKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.47
4 0.46
5 0.46
6 0.45
7 0.41
8 0.4
9 0.42
10 0.42
11 0.4
12 0.47
13 0.51
14 0.47
15 0.47
16 0.46
17 0.39
18 0.3
19 0.28
20 0.23
21 0.2
22 0.19
23 0.19
24 0.19
25 0.18
26 0.19
27 0.17
28 0.13
29 0.11
30 0.11
31 0.12
32 0.12
33 0.12
34 0.11
35 0.11
36 0.12
37 0.12
38 0.11
39 0.1
40 0.1
41 0.1
42 0.1
43 0.09
44 0.07
45 0.06
46 0.07
47 0.06
48 0.06
49 0.07
50 0.07
51 0.07
52 0.07
53 0.08
54 0.08
55 0.09
56 0.11
57 0.12
58 0.13
59 0.12
60 0.12
61 0.12
62 0.14
63 0.13
64 0.12
65 0.1
66 0.09
67 0.1
68 0.09
69 0.09
70 0.08
71 0.16
72 0.17
73 0.24
74 0.25
75 0.27
76 0.32
77 0.36
78 0.35
79 0.34
80 0.38
81 0.38
82 0.4
83 0.41
84 0.38
85 0.36
86 0.37
87 0.36
88 0.36
89 0.38
90 0.45
91 0.51
92 0.57
93 0.65
94 0.74
95 0.8
96 0.83
97 0.85
98 0.86
99 0.88
100 0.88
101 0.87
102 0.83