Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JAG6

Protein Details
Accession A0A2H3JAG6   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
223-245SASEAESTKRRKRNWSEILPAQEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR040976  Pkinase_fungal  
Pfam View protein in Pfam  
PF17667  Pkinase_fungal  
Amino Acid Sequences MSTKELVQVMRDTIKGHLRASLAGVPHRDVSDGNIIIIRDPRKKHTGFLDDFDYSCLVESQHYVDADGNRGSPISDEDLKMVDELKRGLKERTGTPQFVSVALPQVRSVDSNVESIESEPIEHAVCHDLDRALAMDGWPENDKAIPFPPPTLRQKPNEPSDGTLNLGSSGKQKGSMRENGQSSLPTTVEASTHDGAYDGTKKGLDLPHLRSISGPSGTAAEPSASEAESTKRRKRNWSEILPAQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.3
4 0.3
5 0.28
6 0.28
7 0.3
8 0.29
9 0.24
10 0.25
11 0.27
12 0.25
13 0.25
14 0.25
15 0.22
16 0.19
17 0.2
18 0.24
19 0.22
20 0.2
21 0.2
22 0.2
23 0.21
24 0.26
25 0.27
26 0.27
27 0.3
28 0.36
29 0.42
30 0.43
31 0.46
32 0.5
33 0.54
34 0.5
35 0.51
36 0.5
37 0.43
38 0.42
39 0.38
40 0.29
41 0.2
42 0.17
43 0.14
44 0.08
45 0.08
46 0.08
47 0.1
48 0.13
49 0.13
50 0.13
51 0.15
52 0.16
53 0.18
54 0.18
55 0.15
56 0.12
57 0.12
58 0.12
59 0.09
60 0.1
61 0.12
62 0.13
63 0.13
64 0.14
65 0.15
66 0.15
67 0.14
68 0.14
69 0.11
70 0.1
71 0.11
72 0.14
73 0.17
74 0.18
75 0.2
76 0.21
77 0.23
78 0.25
79 0.33
80 0.34
81 0.32
82 0.31
83 0.33
84 0.3
85 0.28
86 0.26
87 0.16
88 0.18
89 0.18
90 0.17
91 0.14
92 0.14
93 0.14
94 0.14
95 0.14
96 0.1
97 0.11
98 0.11
99 0.11
100 0.11
101 0.1
102 0.1
103 0.1
104 0.07
105 0.06
106 0.05
107 0.06
108 0.06
109 0.05
110 0.05
111 0.06
112 0.06
113 0.07
114 0.07
115 0.06
116 0.06
117 0.07
118 0.07
119 0.06
120 0.05
121 0.05
122 0.05
123 0.05
124 0.07
125 0.07
126 0.07
127 0.07
128 0.08
129 0.08
130 0.08
131 0.09
132 0.12
133 0.12
134 0.14
135 0.18
136 0.23
137 0.31
138 0.38
139 0.43
140 0.44
141 0.52
142 0.57
143 0.59
144 0.58
145 0.51
146 0.45
147 0.44
148 0.4
149 0.33
150 0.26
151 0.2
152 0.16
153 0.15
154 0.13
155 0.12
156 0.13
157 0.12
158 0.16
159 0.18
160 0.23
161 0.29
162 0.36
163 0.38
164 0.42
165 0.44
166 0.41
167 0.4
168 0.35
169 0.3
170 0.25
171 0.2
172 0.14
173 0.13
174 0.12
175 0.11
176 0.12
177 0.16
178 0.14
179 0.14
180 0.13
181 0.13
182 0.13
183 0.16
184 0.17
185 0.13
186 0.13
187 0.14
188 0.14
189 0.18
190 0.2
191 0.24
192 0.27
193 0.32
194 0.4
195 0.4
196 0.4
197 0.37
198 0.38
199 0.36
200 0.3
201 0.25
202 0.17
203 0.19
204 0.19
205 0.19
206 0.16
207 0.11
208 0.1
209 0.12
210 0.13
211 0.1
212 0.1
213 0.11
214 0.17
215 0.25
216 0.34
217 0.41
218 0.48
219 0.54
220 0.65
221 0.73
222 0.78
223 0.8
224 0.81
225 0.81