Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3ITV3

Protein Details
Accession A0A2H3ITV3    Localization Confidence High Confidence Score 22.6
NoLS Segment(s)
PositionSequenceProtein Nature
192-226PAAHRVERQRRLPKQPRHPFRRPRQPKARSRQAARBasic
396-419WIATPPPPLKQRQRPGKQVSEGHNHydrophilic
445-468RAVRSLRTPLRHRPSRISNRPAQAHydrophilic
NLS Segment(s)
PositionSequence
165-229RHSRKPQPTPPSVSNARAGKGARSPRQPAAHRVERQRRLPKQPRHPFRRPRQPKARSRQAARQRV
405-440KQRQRPGKQVSEGHNRKKAKNAPMGAERARRARPAT
448-448R
451-451R
453-457PLRHR
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MQARGVPAPPRAPSLQSTAHCGADRLNNRALGLDDPQLHPAPRAYPLGRTNARGIASVPAPVTRATARQAGYSPSAHGGTIRLNNWDLRRCSGLTTKHPRLSVDPRGNPARAPIERGAASARDSPTLGIGQPQSTRAPRRTTPAATTVSHQRKAIRQGQPPSSIRHSRKPQPTPPSVSNARAGKGARSPRQPAAHRVERQRRLPKQPRHPFRRPRQPKARSRQAARQRVGRGADHTNTPLGPATWSYHTPTASHSNRATAALKAYQGTVRIENGTGTRRDGYRASRPRLLDTSHRHHSHSPPGQGISLPRQCHRLSGPLRHRPRQAASDATSPASSGVPGASAAARRQTPSTLPRYSQGAGGDYNNLLSNHPLKSQRAPPNAQGNRLTANRYQPPWIATPPPPLKQRQRPGKQVSEGHNRKKAKNAPMGAERARRARPATYTTPRAVRSLRTPLRHRPSRISNRPAQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.37
4 0.43
5 0.41
6 0.42
7 0.39
8 0.37
9 0.34
10 0.36
11 0.39
12 0.37
13 0.38
14 0.36
15 0.36
16 0.37
17 0.34
18 0.27
19 0.25
20 0.25
21 0.24
22 0.24
23 0.28
24 0.29
25 0.28
26 0.27
27 0.26
28 0.23
29 0.24
30 0.29
31 0.26
32 0.32
33 0.35
34 0.43
35 0.45
36 0.45
37 0.45
38 0.43
39 0.42
40 0.36
41 0.32
42 0.27
43 0.25
44 0.23
45 0.21
46 0.17
47 0.17
48 0.16
49 0.18
50 0.15
51 0.17
52 0.18
53 0.23
54 0.23
55 0.24
56 0.26
57 0.27
58 0.28
59 0.27
60 0.25
61 0.23
62 0.22
63 0.2
64 0.19
65 0.16
66 0.18
67 0.23
68 0.22
69 0.22
70 0.23
71 0.28
72 0.32
73 0.38
74 0.36
75 0.34
76 0.36
77 0.34
78 0.36
79 0.39
80 0.41
81 0.44
82 0.51
83 0.57
84 0.58
85 0.58
86 0.56
87 0.56
88 0.58
89 0.58
90 0.58
91 0.53
92 0.55
93 0.59
94 0.57
95 0.5
96 0.46
97 0.44
98 0.35
99 0.36
100 0.32
101 0.31
102 0.31
103 0.31
104 0.28
105 0.21
106 0.23
107 0.22
108 0.22
109 0.18
110 0.18
111 0.17
112 0.17
113 0.17
114 0.14
115 0.13
116 0.13
117 0.15
118 0.15
119 0.17
120 0.2
121 0.24
122 0.31
123 0.32
124 0.37
125 0.37
126 0.43
127 0.47
128 0.47
129 0.45
130 0.45
131 0.44
132 0.38
133 0.39
134 0.42
135 0.43
136 0.42
137 0.4
138 0.37
139 0.38
140 0.46
141 0.52
142 0.5
143 0.51
144 0.56
145 0.6
146 0.64
147 0.61
148 0.58
149 0.56
150 0.57
151 0.53
152 0.56
153 0.58
154 0.59
155 0.68
156 0.71
157 0.72
158 0.72
159 0.74
160 0.72
161 0.66
162 0.64
163 0.58
164 0.52
165 0.5
166 0.42
167 0.36
168 0.33
169 0.3
170 0.25
171 0.28
172 0.33
173 0.33
174 0.37
175 0.4
176 0.43
177 0.5
178 0.51
179 0.52
180 0.53
181 0.56
182 0.56
183 0.62
184 0.66
185 0.65
186 0.71
187 0.73
188 0.72
189 0.74
190 0.79
191 0.79
192 0.8
193 0.84
194 0.85
195 0.85
196 0.88
197 0.87
198 0.87
199 0.89
200 0.87
201 0.87
202 0.88
203 0.89
204 0.89
205 0.88
206 0.89
207 0.84
208 0.8
209 0.79
210 0.78
211 0.78
212 0.7
213 0.67
214 0.58
215 0.55
216 0.52
217 0.43
218 0.37
219 0.31
220 0.29
221 0.23
222 0.22
223 0.18
224 0.16
225 0.15
226 0.12
227 0.08
228 0.07
229 0.07
230 0.09
231 0.1
232 0.11
233 0.13
234 0.15
235 0.15
236 0.15
237 0.17
238 0.25
239 0.24
240 0.28
241 0.26
242 0.25
243 0.26
244 0.28
245 0.26
246 0.17
247 0.17
248 0.14
249 0.14
250 0.13
251 0.13
252 0.12
253 0.12
254 0.13
255 0.12
256 0.12
257 0.12
258 0.12
259 0.12
260 0.13
261 0.14
262 0.14
263 0.14
264 0.15
265 0.15
266 0.17
267 0.19
268 0.22
269 0.3
270 0.38
271 0.41
272 0.45
273 0.45
274 0.47
275 0.47
276 0.45
277 0.43
278 0.42
279 0.45
280 0.48
281 0.49
282 0.47
283 0.48
284 0.5
285 0.51
286 0.5
287 0.46
288 0.4
289 0.39
290 0.37
291 0.34
292 0.32
293 0.3
294 0.29
295 0.28
296 0.27
297 0.31
298 0.3
299 0.32
300 0.32
301 0.33
302 0.33
303 0.42
304 0.5
305 0.56
306 0.63
307 0.66
308 0.69
309 0.65
310 0.64
311 0.59
312 0.53
313 0.48
314 0.44
315 0.43
316 0.39
317 0.35
318 0.3
319 0.25
320 0.22
321 0.16
322 0.12
323 0.08
324 0.06
325 0.05
326 0.05
327 0.06
328 0.06
329 0.08
330 0.09
331 0.13
332 0.14
333 0.15
334 0.17
335 0.18
336 0.23
337 0.28
338 0.35
339 0.35
340 0.35
341 0.36
342 0.4
343 0.38
344 0.36
345 0.3
346 0.24
347 0.22
348 0.21
349 0.21
350 0.16
351 0.16
352 0.16
353 0.15
354 0.13
355 0.14
356 0.17
357 0.17
358 0.22
359 0.26
360 0.27
361 0.33
362 0.43
363 0.49
364 0.54
365 0.56
366 0.59
367 0.65
368 0.65
369 0.64
370 0.58
371 0.51
372 0.48
373 0.46
374 0.43
375 0.36
376 0.41
377 0.42
378 0.41
379 0.42
380 0.39
381 0.4
382 0.4
383 0.4
384 0.38
385 0.35
386 0.43
387 0.46
388 0.5
389 0.52
390 0.57
391 0.64
392 0.68
393 0.75
394 0.76
395 0.79
396 0.82
397 0.86
398 0.86
399 0.83
400 0.8
401 0.79
402 0.79
403 0.79
404 0.78
405 0.78
406 0.74
407 0.7
408 0.72
409 0.72
410 0.71
411 0.71
412 0.67
413 0.66
414 0.68
415 0.72
416 0.69
417 0.68
418 0.62
419 0.6
420 0.58
421 0.55
422 0.51
423 0.49
424 0.48
425 0.49
426 0.54
427 0.56
428 0.59
429 0.59
430 0.62
431 0.59
432 0.58
433 0.53
434 0.49
435 0.48
436 0.53
437 0.55
438 0.58
439 0.63
440 0.69
441 0.77
442 0.8
443 0.78
444 0.77
445 0.8
446 0.82
447 0.85
448 0.84