Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3JLN9

Protein Details
Accession A0A2H3JLN9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-73ERALRRCRKAGSPRKPRPGTTBasic
NLS Segment(s)
PositionSequence
57-69RRCRKAGSPRKPR
Subcellular Location(s) mito 8, cyto 8, cyto_mito 8, nucl 4, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR020796  ORC5  
IPR047088  ORC5_C  
Gene Ontology GO:0005634  C:nucleus  
GO:0000808  C:origin recognition complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF14630  ORC5_C  
Amino Acid Sequences MEERALQAGAGHDADTDARSLSRMVKFVLVTAFLASTSPAKTDMRMFGRGPDERALRRCRKAGSPRKPRPGTTGTTVKIPQRLLGPMPFPLDRVGPTPCYPGRSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.07
5 0.07
6 0.08
7 0.09
8 0.14
9 0.16
10 0.17
11 0.17
12 0.2
13 0.2
14 0.2
15 0.2
16 0.15
17 0.13
18 0.12
19 0.11
20 0.08
21 0.08
22 0.07
23 0.07
24 0.07
25 0.07
26 0.09
27 0.09
28 0.1
29 0.13
30 0.18
31 0.2
32 0.23
33 0.22
34 0.23
35 0.28
36 0.28
37 0.27
38 0.25
39 0.25
40 0.24
41 0.3
42 0.35
43 0.36
44 0.39
45 0.4
46 0.39
47 0.45
48 0.54
49 0.59
50 0.62
51 0.67
52 0.73
53 0.81
54 0.82
55 0.75
56 0.71
57 0.65
58 0.58
59 0.54
60 0.52
61 0.42
62 0.43
63 0.44
64 0.4
65 0.39
66 0.35
67 0.31
68 0.26
69 0.27
70 0.25
71 0.26
72 0.25
73 0.23
74 0.27
75 0.25
76 0.23
77 0.22
78 0.21
79 0.19
80 0.2
81 0.21
82 0.21
83 0.23
84 0.29
85 0.3