Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JIB5

Protein Details
Accession A0A2H3JIB5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
326-360EDVRRDRHRGEDRRARGERRPPRPRKTQEDLDAELBasic
NLS Segment(s)
PositionSequence
329-351RRDRHRGEDRRARGERRPPRPRK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019416  NCBP3  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0000340  F:RNA 7-methylguanosine cap binding  
Pfam View protein in Pfam  
PF10309  NCBP3  
Amino Acid Sequences MDTNPEGIEVSGEALPYEETTSYEEQLPAPSEPPLPGRSQLADRIGNTKVYLLSETTGMRLGKRKHDDEDGGDNPDGDVEMNEDTSYRENAILFRGSPISHLSTTTIFAYATHFDSRPMALEWIDDTACILVFSSKASARNAYRRLAKSIAEEPSIDDGSVTAKPIPVPLWPPEERISSSLGKGEGLKGAIRMRWATPQDVKKKGAKWESEYYRKYGHTAGKDAEVDEEGDRDRQRKRRRGDMGDELVQKARLDDELDAFLAEEDTTQPPSPPSKMRSDYMGTSGKSLLERTSVMRAQPDTLASRITAQLPHRTRSRRTDDGGDAEDVRRDRHRGEDRRARGERRPPRPRKTQEDLDAELDAFLQSRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.11
5 0.09
6 0.09
7 0.14
8 0.16
9 0.18
10 0.2
11 0.2
12 0.19
13 0.22
14 0.24
15 0.21
16 0.19
17 0.2
18 0.19
19 0.2
20 0.23
21 0.23
22 0.23
23 0.24
24 0.26
25 0.27
26 0.29
27 0.33
28 0.35
29 0.36
30 0.35
31 0.36
32 0.35
33 0.33
34 0.29
35 0.25
36 0.2
37 0.18
38 0.18
39 0.15
40 0.14
41 0.15
42 0.15
43 0.14
44 0.18
45 0.17
46 0.18
47 0.25
48 0.29
49 0.36
50 0.44
51 0.47
52 0.47
53 0.53
54 0.54
55 0.51
56 0.55
57 0.47
58 0.44
59 0.39
60 0.35
61 0.28
62 0.24
63 0.19
64 0.11
65 0.09
66 0.06
67 0.06
68 0.07
69 0.07
70 0.07
71 0.08
72 0.1
73 0.11
74 0.1
75 0.1
76 0.11
77 0.12
78 0.14
79 0.15
80 0.13
81 0.14
82 0.15
83 0.13
84 0.14
85 0.16
86 0.17
87 0.16
88 0.16
89 0.16
90 0.16
91 0.17
92 0.17
93 0.14
94 0.1
95 0.1
96 0.12
97 0.12
98 0.14
99 0.15
100 0.14
101 0.14
102 0.16
103 0.16
104 0.15
105 0.14
106 0.13
107 0.1
108 0.11
109 0.11
110 0.11
111 0.11
112 0.09
113 0.08
114 0.07
115 0.06
116 0.06
117 0.05
118 0.04
119 0.04
120 0.05
121 0.07
122 0.09
123 0.11
124 0.13
125 0.18
126 0.21
127 0.3
128 0.33
129 0.35
130 0.41
131 0.41
132 0.44
133 0.41
134 0.39
135 0.35
136 0.36
137 0.34
138 0.27
139 0.25
140 0.22
141 0.23
142 0.21
143 0.17
144 0.11
145 0.09
146 0.1
147 0.1
148 0.09
149 0.07
150 0.07
151 0.07
152 0.08
153 0.09
154 0.08
155 0.11
156 0.13
157 0.19
158 0.19
159 0.22
160 0.23
161 0.24
162 0.24
163 0.22
164 0.23
165 0.18
166 0.18
167 0.16
168 0.14
169 0.13
170 0.12
171 0.12
172 0.09
173 0.09
174 0.08
175 0.09
176 0.1
177 0.1
178 0.11
179 0.11
180 0.11
181 0.16
182 0.18
183 0.2
184 0.25
185 0.32
186 0.39
187 0.43
188 0.45
189 0.44
190 0.47
191 0.51
192 0.51
193 0.47
194 0.45
195 0.49
196 0.54
197 0.58
198 0.55
199 0.5
200 0.47
201 0.44
202 0.4
203 0.36
204 0.34
205 0.29
206 0.3
207 0.29
208 0.28
209 0.28
210 0.26
211 0.21
212 0.16
213 0.14
214 0.11
215 0.11
216 0.08
217 0.11
218 0.12
219 0.16
220 0.22
221 0.3
222 0.41
223 0.48
224 0.54
225 0.61
226 0.69
227 0.73
228 0.73
229 0.73
230 0.69
231 0.66
232 0.62
233 0.53
234 0.44
235 0.38
236 0.3
237 0.21
238 0.16
239 0.1
240 0.1
241 0.1
242 0.11
243 0.11
244 0.11
245 0.1
246 0.1
247 0.09
248 0.08
249 0.07
250 0.05
251 0.06
252 0.07
253 0.1
254 0.1
255 0.11
256 0.13
257 0.16
258 0.2
259 0.24
260 0.27
261 0.34
262 0.38
263 0.39
264 0.41
265 0.42
266 0.4
267 0.4
268 0.41
269 0.32
270 0.3
271 0.29
272 0.26
273 0.23
274 0.22
275 0.17
276 0.14
277 0.15
278 0.15
279 0.21
280 0.22
281 0.22
282 0.25
283 0.25
284 0.25
285 0.25
286 0.26
287 0.22
288 0.21
289 0.2
290 0.17
291 0.18
292 0.18
293 0.18
294 0.21
295 0.21
296 0.31
297 0.34
298 0.39
299 0.45
300 0.5
301 0.55
302 0.6
303 0.65
304 0.62
305 0.63
306 0.66
307 0.63
308 0.62
309 0.58
310 0.5
311 0.43
312 0.36
313 0.36
314 0.29
315 0.27
316 0.26
317 0.26
318 0.26
319 0.34
320 0.44
321 0.49
322 0.59
323 0.66
324 0.7
325 0.77
326 0.83
327 0.79
328 0.77
329 0.79
330 0.78
331 0.79
332 0.82
333 0.82
334 0.84
335 0.89
336 0.9
337 0.88
338 0.87
339 0.86
340 0.84
341 0.81
342 0.76
343 0.68
344 0.59
345 0.5
346 0.4
347 0.3
348 0.21