Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3JRE0

Protein Details
Accession A0A2H3JRE0   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
74-98RIPDDSSKWRRLRKKSQPPPTIPLDHydrophilic
NLS Segment(s)
PositionSequence
83-88RRLRKK
Subcellular Location(s) nucl 20, mito_nucl 13.333, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MYICITRPDYPTLTDRALNHRYFFMHPYPSHLPDGAHLPEAKAPCQLMSWGSSDNQEEHADRTVTSRTRRIPIRIPDDSSKWRRLRKKSQPPPTIPLDLYDMDDHPEAMPAITSKSPKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.36
4 0.41
5 0.4
6 0.38
7 0.35
8 0.35
9 0.33
10 0.35
11 0.31
12 0.31
13 0.29
14 0.35
15 0.39
16 0.39
17 0.38
18 0.35
19 0.31
20 0.25
21 0.29
22 0.23
23 0.2
24 0.17
25 0.15
26 0.18
27 0.19
28 0.18
29 0.14
30 0.13
31 0.12
32 0.12
33 0.12
34 0.1
35 0.1
36 0.11
37 0.1
38 0.11
39 0.12
40 0.12
41 0.12
42 0.13
43 0.13
44 0.12
45 0.12
46 0.13
47 0.12
48 0.12
49 0.13
50 0.14
51 0.17
52 0.19
53 0.23
54 0.24
55 0.3
56 0.34
57 0.37
58 0.41
59 0.46
60 0.51
61 0.49
62 0.5
63 0.48
64 0.49
65 0.54
66 0.51
67 0.52
68 0.51
69 0.57
70 0.61
71 0.67
72 0.73
73 0.76
74 0.82
75 0.84
76 0.88
77 0.89
78 0.87
79 0.82
80 0.77
81 0.7
82 0.59
83 0.5
84 0.43
85 0.34
86 0.3
87 0.26
88 0.21
89 0.19
90 0.18
91 0.17
92 0.13
93 0.14
94 0.12
95 0.1
96 0.11
97 0.09
98 0.12
99 0.16