Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3J7Y5

Protein Details
Accession A0A2H3J7Y5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
18-40KTPWKLSPTRKANARKRLKNVDAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRQTQTVLGGLVWKTPWKLSPTRKANARKRLKNVDAVIEAVRASGVECGALTKALALPKEHEMSPRDKYTVFTRHARGYRKGIHKVPKWTRLTLRTNPTGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.14
5 0.14
6 0.15
7 0.19
8 0.21
9 0.3
10 0.37
11 0.47
12 0.53
13 0.59
14 0.66
15 0.72
16 0.77
17 0.79
18 0.81
19 0.78
20 0.79
21 0.82
22 0.77
23 0.74
24 0.66
25 0.6
26 0.5
27 0.43
28 0.34
29 0.25
30 0.21
31 0.13
32 0.11
33 0.06
34 0.06
35 0.04
36 0.04
37 0.03
38 0.03
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.05
45 0.07
46 0.08
47 0.08
48 0.11
49 0.14
50 0.16
51 0.16
52 0.18
53 0.19
54 0.23
55 0.28
56 0.28
57 0.26
58 0.24
59 0.27
60 0.3
61 0.35
62 0.35
63 0.36
64 0.38
65 0.45
66 0.5
67 0.54
68 0.53
69 0.53
70 0.58
71 0.6
72 0.65
73 0.64
74 0.68
75 0.69
76 0.75
77 0.76
78 0.77
79 0.73
80 0.72
81 0.73
82 0.72
83 0.73
84 0.71
85 0.7